GR912762
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR912762 vs. TrEMBL
Match: A5CBT6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_043311 PE=4 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 2.345e-13 Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 3 Query: 15 RPRYNSREDLTPRYVPDRFAGLTAYEQSSVQEHNMNYGNKDLRNADRVLDRPVVNPPPARAQETAVS 215 R Y+SRE++ PRY+P+RF G +AY+QSS Q+ N+ Y N+D+R DR DR + PPARA AVS Sbjct: 1667 RTTYSSREEIMPRYIPERFGGPSAYDQSSTQDRNLQYVNRDVRTPDRGFDRSLATSPPARAHGPAVS 1733
BLAST of GR912762 vs. TrEMBL
Match: B9GP88_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_644266 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.777e-12 Identity = 35/62 (56.45%), Postives = 42/62 (67.74%), Query Frame = 3 Query: 15 RPRYNSREDLTPRYVPDRFAGLTAYEQSSVQEHNMNYGNKDLRNADRVLDRPVVNPPPARAQ 200 R Y+ RED+ PRY PDRFA A +Q + QE NMNY N+DLRN D DRP+ + PP RAQ Sbjct: 686 RSNYSPREDIIPRYTPDRFAVPPACDQMNGQERNMNYVNRDLRNLDHGFDRPLGSSPPTRAQ 747
BLAST of GR912762 vs. TrEMBL
Match: B9SKF9_RICCO (Eukaryotic translation initiation factor 4g, putative OS=Ricinus communis GN=RCOM_0658590 PE=4 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.140e-10 Identity = 35/62 (56.45%), Postives = 40/62 (64.52%), Query Frame = 3 Query: 15 RPRYNSREDLTPRYVPDRFAGLTAYEQSSVQEHNMNYGNKDLRNADRVLDRPVVNPPPARAQ 200 RP Y+ RE+ PRY PDRFA A++QSS E NMNY N+D RN DR DR PP RAQ Sbjct: 1486 RPAYSPREEFFPRY-PDRFALPAAFDQSSGHERNMNYVNRDPRNQDRNFDRSHATSPPGRAQ 1546
BLAST of GR912762 vs. TrEMBL
Match: B9MV40_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_677642 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.055e-9 Identity = 31/53 (58.49%), Postives = 36/53 (67.92%), Query Frame = 3 Query: 15 RPRYNSREDLTPRYVPDRFAGLTAYEQSSVQEHNMNYGNKDLRNADRVLDRPV 173 R Y+ REDL PRY PDRFA ++Q S QE NMNY N+DLRN D DRP+ Sbjct: 899 RSNYSPREDLIPRYSPDRFAVPPTHDQMSGQERNMNYVNRDLRNLDHGFDRPL 951
BLAST of GR912762 vs. TrEMBL
Match: A9PHK2_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.055e-9 Identity = 31/53 (58.49%), Postives = 36/53 (67.92%), Query Frame = 3 Query: 15 RPRYNSREDLTPRYVPDRFAGLTAYEQSSVQEHNMNYGNKDLRNADRVLDRPV 173 R Y+ REDL PRY PDRFA ++Q S QE NMNY N+DLRN D DRP+ Sbjct: 403 RSNYSPREDLIPRYSPDRFAVPPTHDQMSGQERNMNYVNRDLRNLDHGFDRPL 455 The following BLAST results are available for this feature:
BLAST of GR912762 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR912762 ID=GR912762; Name=GR912762; organism=Cicer arietinum; type=EST; length=215bpback to top |