HO062766

EST Overview
NameHO062766
Unique NameHO062766
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length422
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
InterProScan analysis for Cicer arietinum unigene v12010-12-29
Libraries
Library NameType
LIBEST_026409 Chickpea drought stressed cDNA SSH library AB2cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO062766 vs. TrEMBL
Match: Q2MGR2_MEDTR (SGS; HSP20-like chaperone OS=Medicago truncatula GN=MtrDRAFT_AC147481g24v2 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.858e-16
Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = -1
Query:  192 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR 314
            GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR
Sbjct:  181 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR 221          
BLAST of HO062766 vs. TrEMBL
Match: C6T3P3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.466e-15
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = -1
Query:  192 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR 314
            GIMD+MKNMYEDGD+EMKKTIAKAWTDARTGKTADPLSSYR
Sbjct:  175 GIMDMMKNMYEDGDDEMKKTIAKAWTDARTGKTADPLSSYR 215          
BLAST of HO062766 vs. TrEMBL
Match: C6SZY3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.266e-15
Identity = 38/41 (92.68%), Postives = 41/41 (100.00%), Query Frame = -1
Query:  192 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR 314
            GIMD+M+NMYEDGDEEMKKTIAKAWTDAR+GKTADPLSSYR
Sbjct:  179 GIMDMMRNMYEDGDEEMKKTIAKAWTDARSGKTADPLSSYR 219          
BLAST of HO062766 vs. TrEMBL
Match: B9S113_RICCO (Calcyclin-binding protein, putative OS=Ricinus communis GN=RCOM_0632630 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.159e-14
Identity = 36/41 (87.80%), Postives = 39/41 (95.12%), Query Frame = -1
Query:  192 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR 314
            GIMDLMKNMYE+GDEEMK+TIAKAWTDAR+GKTADPL  YR
Sbjct:  177 GIMDLMKNMYEEGDEEMKRTIAKAWTDARSGKTADPLKGYR 217          
BLAST of HO062766 vs. TrEMBL
Match: B9NBM2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_675455 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.517e-12
Identity = 33/41 (80.49%), Postives = 37/41 (90.24%), Query Frame = -1
Query:  192 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR 314
            GIMDLMKNMY+DGDE+MK+TIAKAWTDAR+G  ADPL  YR
Sbjct:  181 GIMDLMKNMYDDGDEDMKRTIAKAWTDARSGNAADPLKGYR 221          
BLAST of HO062766 vs. TrEMBL
Match: A9PJ88_9ROSI (Putative uncharacterized protein OS=Populus trichocarpa x Populus deltoides PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.517e-12
Identity = 33/41 (80.49%), Postives = 37/41 (90.24%), Query Frame = -1
Query:  192 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR 314
            GIMDLMKNMY+DGDE+MK+TIAKAWTDAR+G  ADPL  YR
Sbjct:  181 GIMDLMKNMYDDGDEDMKRTIAKAWTDARSGNAADPLKGYR 221          
BLAST of HO062766 vs. TrEMBL
Match: D7TK67_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_3.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00021471001 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.981e-12
Identity = 33/40 (82.50%), Postives = 38/40 (95.00%), Query Frame = -1
Query:  195 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSY 314
            GIMDLMKNMYE+GD+EMK+TIAKAW+DAR+GKTADPL  Y
Sbjct:  178 GIMDLMKNMYEEGDDEMKQTIAKAWSDARSGKTADPLKGY 217          
BLAST of HO062766 vs. TrEMBL
Match: B4FGY0_MAIZE (Calcyclin-binding protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.834e-12
Identity = 33/41 (80.49%), Postives = 37/41 (90.24%), Query Frame = -1
Query:  192 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPLSSYR 314
            GIMDLMKNMYEDGDE+MK+TIAKAW+DAR+GKT D LS  R
Sbjct:  177 GIMDLMKNMYEDGDEDMKRTIAKAWSDARSGKTTDSLSGLR 217          
BLAST of HO062766 vs. TrEMBL
Match: Q9C8R4_ARATH (Putative uncharacterized protein OS=Arabidopsis thaliana GN=At1g30070/T1P2_12 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.191e-11
Identity = 32/37 (86.49%), Postives = 35/37 (94.59%), Query Frame = -1
Query:  204 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPL 314
            GIM +MKN+YEDGDEEMKKTIAKAWTDAR+GK ADPL
Sbjct:  183 GIMGMMKNLYEDGDEEMKKTIAKAWTDARSGKAADPL 219          
BLAST of HO062766 vs. TrEMBL
Match: D7KEQ1_ARALY (SGS domain-containing protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_890543 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.191e-11
Identity = 32/37 (86.49%), Postives = 35/37 (94.59%), Query Frame = -1
Query:  204 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPL 314
            GIM +MKN+YEDGDEEMKKTIAKAWTDAR+GK ADPL
Sbjct:  182 GIMGMMKNLYEDGDEEMKKTIAKAWTDARSGKAADPL 218          
BLAST of HO062766 vs. TAIR peptide
Match: AT1G30070.2 (| Symbols: | SGS domain-containing protein | chr1:10546794-10548072 REVERSE LENGTH=229)

HSP 1 Score: 72.7886 bits (177), Expect = 7.695e-14
Identity = 35/52 (67.31%), Postives = 39/52 (75.00%), Query Frame = -1
Query:  204 VQFLSSSHHRRKNGRGIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPL 359
            VQ   S    +    GIM +MKN+YEDGDEEMKKTIAKAWTDAR+GK ADPL
Sbjct:  175 VQIKPSLEKEKDPMAGIMGMMKNLYEDGDEEMKKTIAKAWTDARSGKAADPL 226          
BLAST of HO062766 vs. TAIR peptide
Match: AT1G30070.1 (| Symbols: | SGS domain-containing protein | chr1:10546794-10548072 REVERSE LENGTH=222)

HSP 1 Score: 72.0182 bits (175), Expect = 1.313e-13
Identity = 32/37 (86.49%), Postives = 35/37 (94.59%), Query Frame = -1
Query:  204 GIMDLMKNMYEDGDEEMKKTIAKAWTDARTGKTADPL 314
            GIM +MKN+YEDGDEEMKKTIAKAWTDAR+GK ADPL
Sbjct:  183 GIMGMMKNLYEDGDEEMKKTIAKAWTDARSGKAADPL 219          
BLAST of HO062766 vs. TAIR peptide
Match: AT1G30060.1 (| Symbols: | COP1-interacting protein-related | chr1:10545087-10545906 REVERSE LENGTH=176)

HSP 1 Score: 54.299 bits (129), Expect = 2.832e-8
Identity = 24/26 (92.31%), Postives = 25/26 (96.15%), Query Frame = -1
Query:  204 DGDEEMKKTIAKAWTDARTGKTADPL 281
            DGDEEMKKTIAKAWTDAR+GK ADPL
Sbjct:  148 DGDEEMKKTIAKAWTDARSGKAADPL 173          
The following BLAST results are available for this feature:
BLAST of HO062766 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q2MGR2_MEDTR3.858e-16100.00SGS; HSP20-like chaperone OS=Medicago truncatula G... [more]
C6T3P3_SOYBN1.466e-1595.12Putative uncharacterized protein OS=Glycine max PE... [more]
C6SZY3_SOYBN4.266e-1592.68Putative uncharacterized protein OS=Glycine max PE... [more]
B9S113_RICCO6.159e-1487.80Calcyclin-binding protein, putative OS=Ricinus com... [more]
B9NBM2_POPTR1.517e-1280.49Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A9PJ88_9ROSI1.517e-1280.49Putative uncharacterized protein OS=Populus tricho... [more]
D7TK67_VITVI1.981e-1282.50Whole genome shotgun sequence of line PN40024, sca... [more]
B4FGY0_MAIZE9.834e-1280.49Calcyclin-binding protein OS=Zea mays PE=2 SV=1[more]
Q9C8R4_ARATH2.191e-1186.49Putative uncharacterized protein OS=Arabidopsis th... [more]
D7KEQ1_ARALY2.191e-1186.49SGS domain-containing protein OS=Arabidopsis lyrat... [more]
back to top
BLAST of HO062766 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT1G30070.27.695e-1467.31| Symbols: | SGS domain-containing protein | chr1... [more]
AT1G30070.11.313e-1386.49| Symbols: | SGS domain-containing protein | chr1... [more]
AT1G30060.12.832e-892.31| Symbols: | COP1-interacting protein-related | c... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007699SGSPFAMPF05002SGScoord: 12..49
score: 8.8
IPR007699SGSPROFILEPS51048SGScoord: 1..61
score: 11
NoneNo IPR availablePANTHERPTHR13164CALICYLIN BINDING PROTEINcoord: 21..59
score: 5.8

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO062766 ID=HO062766|Name=HO062766|organism=Cicer arietinum|type=EST|length=422bp
GAACAACCACTGCCAAAAATCACATCTTTGATCTTTCAATAAGTAGAACT
TAAGCAACAATAGTACTGCACATTAAATTTCTACGGTGCCATGTAAGTAA
ACCAAGCATTCATTTTATAACATGAAATTAAGTGAAGCATATCACTCCCA
TGAAACAGGAATTCAACATCTAAACCATTATCAGCTGCTCAACGATAGCT
ACTTAAAGGGTCAGCTGTTTTTCCAGTTCTAGCATCAGTCCATGCTTTTG
CAATTGTTTTCTTCATCTCCTCGTCCCCATCCTCATACATATTCTTCATC
AAGTCCATGATTCCTCTGCCATTTTTTCTCCGATGATGCGACGACGATAG
AAACTGAACCTTCGTTTTCAAAAACTAACTTTGTAATTTTATTATTGGTG
GTAATGTGTGTCCCGCGTACCT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR007699SGS_dom