GR912929
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR912929 vs. TrEMBL
Match: Q6XAF4_PEA (Ent-kaurene oxidase OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.126e-7 Identity = 23/33 (69.70%), Postives = 32/33 (96.97%), Query Frame = 3 Query: 12 EVNCFYDYLISEAKELTEEQLLMLVWEPIVEAS 110 E++C+YDYL+SEAKE+TEEQ++ML+WEPI+E S Sbjct: 275 ELDCYYDYLVSEAKEVTEEQMIMLLWEPIIETS 307
BLAST of GR912929 vs. TrEMBL
Match: Q2LAK0_SOYBN (Cytochrome P450 monooxygenase CYP701A16 (Fragment) OS=Glycine max GN=CYP701A16 PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.590e-7 Identity = 23/33 (69.70%), Postives = 30/33 (90.91%), Query Frame = 3 Query: 12 EVNCFYDYLISEAKELTEEQLLMLVWEPIVEAS 110 EVNC++DYL+SEAKELTE+Q+ ML+WE I+E S Sbjct: 277 EVNCYFDYLVSEAKELTEDQISMLIWETIIETS 309
BLAST of GR912929 vs. TrEMBL
Match: A5YN45_SOYBN (Cyochrome P450 monooxygenase CYP701A16 (Fragment) OS=Glycine max PE=3 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.590e-7 Identity = 23/33 (69.70%), Postives = 30/33 (90.91%), Query Frame = 3 Query: 12 EVNCFYDYLISEAKELTEEQLLMLVWEPIVEAS 110 EVNC++DYL+SEAKELTE+Q+ ML+WE I+E S Sbjct: 258 EVNCYFDYLVSEAKELTEDQISMLIWETIIETS 290 The following BLAST results are available for this feature:
BLAST of GR912929 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR912929 ID=GR912929; Name=GR912929; organism=Cicer arietinum; type=EST; length=111bpback to top |