GR916662
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR916662 vs. SwissProt
Match: DNJH1_ALLPO (DnaJ protein homolog 1 (Fragment) OS=Allium porrum GN=DNAJ1 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.334e-12 Identity = 30/41 (73.17%), Postives = 35/41 (85.37%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ DDL+ H LSLTEALCGFQF +THLDGRQLL+K Sbjct: 241 HPKFQRKGDDLFYKHTLSLTEALCGFQFVLTHLDGRQLLIK 281
BLAST of GR916662 vs. SwissProt
Match: DNJH_CUCSA (DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.967e-12 Identity = 28/41 (68.29%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ DDL+++H LSL E+LCGFQF +THLDGRQLL+K Sbjct: 260 HPKFKRKGDDLFVEHTLSLVESLCGFQFILTHLDGRQLLIK 300
BLAST of GR916662 vs. SwissProt
Match: DNJH2_ALLPO (DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.967e-12 Identity = 29/41 (70.73%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ DDL+ +H+LSLTEALCGFQF +THLD RQLL+K Sbjct: 262 HPKFKRKGDDLFYEHSLSLTEALCGFQFVLTHLDNRQLLIK 302
BLAST of GR916662 vs. SwissProt
Match: DNAJ3_ARATH (Chaperone protein dnaJ 3 OS=Arabidopsis thaliana GN=ATJ3 PE=1 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 6.967e-12 Identity = 28/41 (68.29%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ +DL+++H LSLTEALCGFQF +THLDGR LL+K Sbjct: 262 HPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIK 302
BLAST of GR916662 vs. SwissProt
Match: DNJH_ATRNU (DnaJ protein homolog ANJ1 OS=Atriplex nummularia PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.552e-11 Identity = 28/41 (68.29%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ +DL+ +H LSLTEALCGF+F +THLDGRQLL+K Sbjct: 262 HPKFKRKGEDLFYEHTLSLTEALCGFRFVLTHLDGRQLLIK 302
BLAST of GR916662 vs. SwissProt
Match: DNAJ2_ARATH (Chaperone protein dnaJ 2 OS=Arabidopsis thaliana GN=ATJ2 PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 2.647e-11 Identity = 27/41 (65.85%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ +DL+++H +SLTEALCGFQF +THLD RQLL+K Sbjct: 263 HPKFKRKGEDLFVEHTISLTEALCGFQFVLTHLDKRQLLIK 303
BLAST of GR916662 vs. SwissProt
Match: DNJA2_HUMAN (DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 1.360e-7 Identity = 23/41 (56.10%), Postives = 32/41 (78.05%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 H F+R+ +DL++ + + L EALCGFQFT HLDGRQ++VK Sbjct: 257 HEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVK 297
BLAST of GR916662 vs. SwissProt
Match: DNJA2_BOVIN (DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 1.360e-7 Identity = 23/41 (56.10%), Postives = 32/41 (78.05%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 H F+R+ +DL++ + + L EALCGFQFT HLDGRQ++VK Sbjct: 257 HEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVK 297
BLAST of GR916662 vs. SwissProt
Match: DNJA2_RAT (DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=2 SV=1) HSP 1 Score: 52.7582 bits (125), Expect = 6.748e-7 Identity = 22/41 (53.66%), Postives = 31/41 (75.61%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 H F+R+ +DL++ + + L EALCGFQFT HLD RQ++VK Sbjct: 257 HEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVK 297
BLAST of GR916662 vs. SwissProt
Match: DNJA2_MOUSE (DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1) HSP 1 Score: 52.7582 bits (125), Expect = 6.748e-7 Identity = 22/41 (53.66%), Postives = 31/41 (75.61%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 H F+R+ +DL++ + + L EALCGFQFT HLD RQ++VK Sbjct: 257 HEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVK 297
BLAST of GR916662 vs. TrEMBL
Match: C6TN54_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 4.699e-14 Identity = 36/41 (87.80%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP FRRE DDLYIDHNLSLTEALCGFQF V HLDGRQLL+K Sbjct: 263 HPKFRREQDDLYIDHNLSLTEALCGFQFAVKHLDGRQLLIK 303
BLAST of GR916662 vs. TrEMBL
Match: B7FID9_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 8.015e-14 Identity = 36/41 (87.80%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP FRRE DDL+I+HNLSLTEALCGFQF VTHLDGRQLLVK Sbjct: 264 HPKFRRERDDLHIEHNLSLTEALCGFQFNVTHLDGRQLLVK 304
BLAST of GR916662 vs. TrEMBL
Match: O24074_MEDSA (DnaJ-like protein OS=Medicago sativa GN=msj1 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.785e-13 Identity = 35/41 (85.37%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP FRRE DDL+I+HNLSLT+ALCGFQF VTHLDGRQLLVK Sbjct: 264 HPKFRRERDDLHIEHNLSLTDALCGFQFNVTHLDGRQLLVK 304
BLAST of GR916662 vs. TrEMBL
Match: B9RQ46_RICCO (Chaperone protein dnaJ, putative OS=Ricinus communis GN=RCOM_0954960 PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.511e-12 Identity = 32/41 (78.05%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ DDL +DHNLSLTEALCGFQF +THLDGRQLL+K Sbjct: 262 HPKFKRKEDDLVVDHNLSLTEALCGFQFVLTHLDGRQLLIK 302
BLAST of GR916662 vs. TrEMBL
Match: C5XRY7_SORBI (Putative uncharacterized protein Sb04g032970 OS=Sorghum bicolor GN=Sb04g032970 PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 2.578e-12 Identity = 30/41 (73.17%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R++DDLY++H +SLTEALCGFQF +THLDGRQLL+K Sbjct: 264 HPKFKRKYDDLYVEHTISLTEALCGFQFVLTHLDGRQLLIK 304
BLAST of GR916662 vs. TrEMBL
Match: B4FJC3_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.744e-12 Identity = 30/41 (73.17%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R +DDLY++H +SLTEALCGFQF +THLDGRQLL+K Sbjct: 265 HPKFKRMYDDLYVEHTISLTEALCGFQFVLTHLDGRQLLIK 305
BLAST of GR916662 vs. TrEMBL
Match: C5YDG6_SORBI (Putative uncharacterized protein Sb06g024520 OS=Sorghum bicolor GN=Sb06g024520 PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 7.501e-12 Identity = 30/41 (73.17%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R++DDL+I+H +SLTEALCGFQF +THLDGRQLL+K Sbjct: 261 HPRFKRKYDDLFIEHTISLTEALCGFQFILTHLDGRQLLIK 301
BLAST of GR916662 vs. TrEMBL
Match: Q9ZWK3_SALGI (DnaJ homolog OS=Salix gilgiana GN=SGJ3 PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.280e-11 Identity = 30/41 (73.17%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ DDL+++H LSLTEALCGFQF +THLDGRQLL+K Sbjct: 264 HPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIK 304
BLAST of GR916662 vs. TrEMBL
Match: D7SLV4_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_21.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00018226001 PE=4 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.280e-11 Identity = 30/41 (73.17%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 H F+R++DDLY++H LSLTEALCGFQF +THLDGRQLL+K Sbjct: 262 HAKFKRKYDDLYVEHTLSLTEALCGFQFALTHLDGRQLLIK 302
BLAST of GR916662 vs. TrEMBL
Match: A5C8A7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_005641 PE=3 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.280e-11 Identity = 30/41 (73.17%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 H F+R++DDLY++H LSLTEALCGFQF +THLDGRQLL+K Sbjct: 262 HAKFKRKYDDLYVEHTLSLTEALCGFQFALTHLDGRQLLIK 302
BLAST of GR916662 vs. TAIR peptide
Match: AT3G44110.2 (| Symbols: ATJ3, ATJ | DNAJ homologue 3 | chr3:15869179-15871059 REVERSE LENGTH=343) HSP 1 Score: 69.3218 bits (168), Expect = 5.338e-13 Identity = 28/41 (68.29%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ +DL+++H LSLTEALCGFQF +THLDGR LL+K Sbjct: 262 HPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIK 302
BLAST of GR916662 vs. TAIR peptide
Match: AT3G44110.1 (| Symbols: ATJ3, ATJ | DNAJ homologue 3 | chr3:15869115-15871059 REVERSE LENGTH=420) HSP 1 Score: 69.3218 bits (168), Expect = 5.338e-13 Identity = 28/41 (68.29%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ +DL+++H LSLTEALCGFQF +THLDGR LL+K Sbjct: 262 HPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIK 302
BLAST of GR916662 vs. TAIR peptide
Match: AT5G22060.1 (| Symbols: ATJ2, J2 | DNAJ homologue 2 | chr5:7303798-7305668 REVERSE LENGTH=419) HSP 1 Score: 67.3958 bits (163), Expect = 2.029e-12 Identity = 27/41 (65.85%), Postives = 36/41 (87.80%), Query Frame = 2 Query: 29 HPNFRREHDDLYIDHNLSLTEALCGFQFTVTHLDGRQLLVK 151 HP F+R+ +DL+++H +SLTEALCGFQF +THLD RQLL+K Sbjct: 263 HPKFKRKGEDLFVEHTISLTEALCGFQFVLTHLDKRQLLIK 303 The following BLAST results are available for this feature:
BLAST of GR916662 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 10
BLAST of GR916662 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GR916662 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR916662 ID=GR916662; Name=GR916662; organism=Cicer arietinum; type=EST; length=151bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|