GR396872
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR396872 vs. TrEMBL
Match: B9GTQ8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_645017 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.240e-7 Identity = 28/35 (80.00%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 4 VNGSDGVFVTGGEFSQISEMNHLMVSDSMRYAILM 108 VNG+DG++VTG EF+Q+SEMNHLMV+DSMRYAILM Sbjct: 73 VNGADGLWVTG-EFAQLSEMNHLMVNDSMRYAILM 106
BLAST of GR396872 vs. TrEMBL
Match: C6TF73_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.526e-7 Identity = 29/36 (80.56%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 1 RVNGSDGVFVTGGEFSQISEMNHLMVSDSMRYAILM 108 + NGSDGV+V+G EF QISEMNHLMV+DSMRYAILM Sbjct: 73 QANGSDGVWVSG-EFVQISEMNHLMVNDSMRYAILM 107
BLAST of GR396872 vs. TAIR peptide
Match: AT5G35732.1 (| Symbols: | unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G04795.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr5:13897961-13898263 FORWARD LENGTH=100) HSP 1 Score: 52.373 bits (124), Expect = 6.995e-8 Identity = 25/36 (69.44%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 1 RVNGSDGVFVTGGEFSQISEMNHLMVSDSMRYAILM 108 RV+G+DG++V+G ++ ISE+NHLMVSDSMRYAILM Sbjct: 66 RVSGTDGLWVSG-DYGSISEVNHLMVSDSMRYAILM 100 The following BLAST results are available for this feature:
BLAST of GR396872 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of GR396872 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR396872 ID=GR396872; Name=GR396872; organism=Cicer arietinum; type=EST; length=158bpback to top |