HO065449

EST Overview
NameHO065449
Unique NameHO065449
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length328
Libraries
Library NameType
LIBEST_026412 Chickpea drought stressed cDNA SSH library AS1cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO065449 vs. SwissProt
Match: HS21C_PEA (Small heat shock protein, chloroplastic OS=Pisum sativum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 8.441e-10
Identity = 37/74 (50.00%), Postives = 44/74 (59.46%), Query Frame = -1
Query:  107 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVLXIXXXXXXXXXXVXXVQIQ 328
            VE D+LVIKSD  +     +  WS K+ S Y+T  KLPDNC K+KVKAE K+GVL I          V  VQIQ
Sbjct:  160 VEDDVLVIKSDHREENGGEDC-WSRKSYSCYDTRLKLPDNCEKEKVKAELKDGVLYITIPKTKIERTVIDVQIQ 232          
BLAST of HO065449 vs. SwissProt
Match: HS25P_ARATH (25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.189e-9
Identity = 35/74 (47.30%), Postives = 42/74 (56.76%), Query Frame = -1
Query:  107 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVLXIXXXXXXXXXXVXXVQIQ 328
            VE ++LVIK +  K        WS ++ SSY T  +LPDNC KDK+KAE KNGVL I          V  VQIQ
Sbjct:  156 VEDNVLVIKGEQKKEDSDDS--WSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ 227          
BLAST of HO065449 vs. SwissProt
Match: HS22C_SOYBN (Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.189e-9
Identity = 36/75 (48.00%), Postives = 42/75 (56.00%), Query Frame = -1
Query:  107 VEGDILVIKSDFX-KXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVLXIXXXXXXXXXXVXXVQIQ 328
            VE D+LVIK     +     +  WS +  SSY+T  KLPDNC KDKVKAE KNGVL I          V  VQ+Q
Sbjct:  107 VEDDMLVIKGGHKSEQEHGGDDSWSSRTYSSYDTRLKLPDNCEKDKVKAELKNGVLYITIPKTKVERKVIDVQVQ 181          
BLAST of HO065449 vs. SwissProt
Match: HS22C_PETHY (Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 2.715e-8
Identity = 31/57 (54.39%), Postives = 36/57 (63.16%), Query Frame = -1
Query:  158 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVLXI 328
            VE D+LVIK +  K     +  W  +N SSY+T   LPDN  KDKVKAE KNGVL I
Sbjct:  169 VEDDVLVIKGEHKKEESGKDDSWG-RNYSSYDTRLSLPDNVDKDKVKAELKNGVLLI 224          
BLAST of HO065449 vs. SwissProt
Match: HS21C_SOLLC (Small heat shock protein, chloroplastic OS=Solanum lycopersicum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.760e-7
Identity = 29/57 (50.88%), Postives = 35/57 (61.40%), Query Frame = -1
Query:  158 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVLXI 328
            VE D+LVIK +  K     +     +N SSY+T   LPDN  KDK+KAE KNGVL I
Sbjct:  162 VENDMLVIKGEHKKEEDGRDKHSWGRNYSSYDTRLSLPDNVVKDKIKAELKNGVLFI 218          
BLAST of HO065449 vs. TrEMBL
Match: B9I224_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1095126 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.332e-8
Identity = 36/74 (48.65%), Postives = 43/74 (58.11%), Query Frame = -1
Query:  107 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVLXIXXXXXXXXXXVXXVQIQ 328
            VE D+LVIK +  K     +  WS  + SSY+T  +LPDNC KDK+KAE KNGVL I          V  VQIQ
Sbjct:  166 VEDDVLVIKGEHKKEETGDDS-WSSSSVSSYDTRLRLPDNCGKDKIKAELKNGVLFINIPKTKVEPKVIDVQIQ 238          
BLAST of HO065449 vs. TrEMBL
Match: A7WLG5_9MAGN (Chloroplast small heat shock protein (Fragment) OS=Machilus thunbergii GN=cpsHSP PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.332e-8
Identity = 32/55 (58.18%), Postives = 37/55 (67.27%), Query Frame = -1
Query:  164 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVL 328
            VE D+LVIK +  +     E  WS ++ SSYNT   LPDNC KDKVKAE KNGVL
Sbjct:   56 VEDDMLVIKGEHKEEKEGGEVSWSSRSSSSYNTRLLLPDNCEKDKVKAELKNGVL 110          
BLAST of HO065449 vs. TrEMBL
Match: A7WLF9_9MAGN (Chloroplast small heat shock protein (Fragment) OS=Persea japonica GN=cpsHSP PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.332e-8
Identity = 32/55 (58.18%), Postives = 37/55 (67.27%), Query Frame = -1
Query:  164 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVL 328
            VE D+LVIK +  +     E  WS ++ SSYNT   LPDNC KDKVKAE KNGVL
Sbjct:   56 VEDDMLVIKGEHKEEKEGGEVSWSSRSSSSYNTRLLLPDNCEKDKVKAELKNGVL 110          
BLAST of HO065449 vs. TrEMBL
Match: A9QVH3_9FABA (Heat shock protein OS=Ammopiptanthus mongolicus GN=hsp PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.739e-8
Identity = 33/57 (57.89%), Postives = 37/57 (64.91%), Query Frame = -1
Query:  158 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVLXI 328
            VE D+LVIK D  K     +  WS K  SSY+T   +PDNC KDKVKAE KNGVL I
Sbjct:  161 VEDDVLVIKGDHKKEQGGDDS-WSSKTYSSYDTRLMIPDNCEKDKVKAELKNGVLYI 216          
BLAST of HO065449 vs. TrEMBL
Match: A7WLG2_9MAGN (Chloroplast small heat shock protein (Fragment) OS=Machilus mushaensis GN=cpsHSP PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.739e-8
Identity = 31/55 (56.36%), Postives = 37/55 (67.27%), Query Frame = -1
Query:  164 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVL 328
            VE D+LVIK +  +     E  WS ++ SSYNT   LPDNC KDK+KAE KNGVL
Sbjct:   56 VEDDMLVIKGEHKEEKEGGEESWSSRSSSSYNTRLLLPDNCEKDKIKAEFKNGVL 110          
BLAST of HO065449 vs. TrEMBL
Match: A7WLG1_9MAGN (Chloroplast small heat shock protein (Fragment) OS=Persea kusanoi GN=cpsHSP PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.739e-8
Identity = 31/55 (56.36%), Postives = 37/55 (67.27%), Query Frame = -1
Query:  164 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVL 328
            VE D+LVIK +  +     E  WS ++ SSYNT   LPDNC KDK+KAE KNGVL
Sbjct:   56 VEDDMLVIKGEHKEEKEGGEESWSSRSSSSYNTRLLLPDNCEKDKIKAELKNGVL 110          
BLAST of HO065449 vs. TrEMBL
Match: A7WLG3_9MAGN (Chloroplast small heat shock protein (Fragment) OS=Persea obovatifolia GN=cpsHSP PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.271e-8
Identity = 30/55 (54.55%), Postives = 37/55 (67.27%), Query Frame = -1
Query:  164 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVL 328
            VE D+LV+K +  +     E  WS ++ SSYNT   LPDNC KDK+KAE KNGVL
Sbjct:   56 VEDDMLVVKGEHKEEKEGGEESWSSRSSSSYNTRLLLPDNCEKDKIKAELKNGVL 110          
BLAST of HO065449 vs. TrEMBL
Match: A7WLF8_RHOSS (Chloroplast small heat shock protein (Fragment) OS=Rhododendron simsii GN=cpsHSP PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.271e-8
Identity = 32/55 (58.18%), Postives = 38/55 (69.09%), Query Frame = -1
Query:  164 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVL 328
            VE D+LVIK +  K     +  WS K+ SSY+T  +LPDNC KDKVKAE KNGVL
Sbjct:   59 VEDDVLVIKGEHKKEGGGDDS-WSGKSYSSYDTRLRLPDNCEKDKVKAELKNGVL 112          
BLAST of HO065449 vs. TrEMBL
Match: A7WLF5_9ERIC (Chloroplast small heat shock protein (Fragment) OS=Rhododendron rubropilosum GN=cpsHSP PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.271e-8
Identity = 32/55 (58.18%), Postives = 38/55 (69.09%), Query Frame = -1
Query:  164 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVL 328
            VE D+LVIK +  K     +  WS K+ SSY+T  +LPDNC KDKVKAE KNGVL
Sbjct:   59 VEDDVLVIKGEHKKEGGGDDS-WSGKSYSSYDTRLRLPDNCEKDKVKAELKNGVL 112          
BLAST of HO065449 vs. TrEMBL
Match: A7WLF4_9ERIC (Chloroplast small heat shock protein (Fragment) OS=Rhododendron ovatum GN=cpsHSP PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.271e-8
Identity = 32/55 (58.18%), Postives = 38/55 (69.09%), Query Frame = -1
Query:  164 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVL 328
            VE D+LVIK +  K     +  WS K+ SSY+T  +LPDNC KDKVKAE KNGVL
Sbjct:   59 VEDDVLVIKGEHKKEGGGDDS-WSGKSYSSYDTRLRLPDNCEKDKVKAELKNGVL 112          
BLAST of HO065449 vs. TAIR peptide
Match: AT4G27670.1 (| Symbols: HSP21 | heat shock protein 21 | chr4:13819048-13819895 REVERSE LENGTH=227)

HSP 1 Score: 60.077 bits (144), Expect = 3.320e-10
Identity = 35/74 (47.30%), Postives = 42/74 (56.76%), Query Frame = -1
Query:  107 VEGDILVIKSDFXKXXXXXEXFWSXKNXSSYNTXXKLPDNCXKDKVKAEXKNGVLXIXXXXXXXXXXVXXVQIQ 328
            VE ++LVIK +  K        WS ++ SSY T  +LPDNC KDK+KAE KNGVL I          V  VQIQ
Sbjct:  156 VEDNVLVIKGEQKKEDSDDS--WSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ 227          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 5
Match NameE-valueIdentityDescription
HS21C_PEA8.441e-1050.00Small heat shock protein, chloroplastic OS=Pisum s... [more]
HS25P_ARATH4.189e-947.3025.3 kDa heat shock protein, chloroplastic OS=Arab... [more]
HS22C_SOYBN4.189e-948.00Small heat shock protein, chloroplastic (Fragment)... [more]
HS22C_PETHY2.715e-854.39Small heat shock protein, chloroplastic OS=Petunia... [more]
HS21C_SOLLC1.760e-750.88Small heat shock protein, chloroplastic OS=Solanum... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9I224_POPTR1.332e-848.65Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A7WLG5_9MAGN1.332e-858.18Chloroplast small heat shock protein (Fragment) OS... [more]
A7WLF9_9MAGN1.332e-858.18Chloroplast small heat shock protein (Fragment) OS... [more]
A9QVH3_9FABA1.739e-857.89Heat shock protein OS=Ammopiptanthus mongolicus GN... [more]
A7WLG2_9MAGN1.739e-856.36Chloroplast small heat shock protein (Fragment) OS... [more]
A7WLG1_9MAGN1.739e-856.36Chloroplast small heat shock protein (Fragment) OS... [more]
A7WLG3_9MAGN2.271e-854.55Chloroplast small heat shock protein (Fragment) OS... [more]
A7WLF8_RHOSS2.271e-858.18Chloroplast small heat shock protein (Fragment) OS... [more]
A7WLF5_9ERIC2.271e-858.18Chloroplast small heat shock protein (Fragment) OS... [more]
A7WLF4_9ERIC2.271e-858.18Chloroplast small heat shock protein (Fragment) OS... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT4G27670.13.320e-1047.30| Symbols: HSP21 | heat shock protein 21 | chr4:13... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 22..29
score
NoneNo IPR availableGENE3D2.60.40.790no descriptioncoord: 2..74
score: 1.8
NoneNo IPR availablePANTHERPTHR11527SMALL HEAT-SHOCK PROTEIN (HSP20) FAMILYcoord: 1..74
score: 5.4
NoneNo IPR availablePANTHERPTHR11527:SF18HEAT SHOCK PROTEIN 26coord: 1..74
score: 5.4
NoneNo IPR availableSEGsegsegcoord: 15..36
score: NAcoord: 58..71
score
IPR002068Heat shock protein Hsp20PFAMPF00011HSP20coord: 1..74
score: 5.1
IPR002068Heat shock protein Hsp20PROFILEPS01031HSP20coord: 1..61
score: 10
IPR008978HSP20-like chaperoneSUPERFAMILY49764HSP20-like chaperonescoord: 1..75
score: 3.1

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO065449 ID=HO065449|Name=HO065449|organism=Cicer arietinum|type=EST|length=328bp
GGAGGAAGTAGAAATTTGTGAGACATTNATATAACATANTTAAAGTATCT
TATTCATTCTACACTTTATAGCNCANGATGACNCTANAAAAAGCCTTANN
GTGTCNCTGAATTTGAACNTNNANAACCTTACGTCNNACTTTGGGCTTAG
GAACNTTGATNTAAAGCACACCATTTTTCANCTCTGCCTTAACCTTATCC
TTCNCACAGTTATCAGGAAGCTTGANACNAGTATTATAAGAACTATNGTT
TTTTNTTGACCAAAAANCCTCTTCACNACTTTCCTCCTTANGAAAATCAC
TTTTTATGACAAGAATATCGCCCTCNAC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR002068A-crystallin/Hsp20_dom
IPR008978HSP20-like_chaperone