FL512450
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FL512450 vs. TrEMBL
Match: Q935G9_SALTI (Putative membrane protein OS=Salmonella typhi GN=HCM1.272 PE=4 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 1.730e-16 Identity = 40/80 (50.00%), Postives = 60/80 (75.00%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ DE LG PFY FHPAQP +SV IDVC+ SDLT+RL+SL+S + + F+++ E+LI+++I Sbjct: 231 VIDPKNDAEWRQSLMDEASELGLPFYKFHPAQPSSSVCIDVCNAYTNVSDLTSRLLSLVSVPGEVNPFVQYAEALISTVI 310
BLAST of FL512450 vs. TrEMBL
Match: C8UQT0_ECO1A (Conjugative coupling factor OS=Escherichia coli O111:H- (strain 11128 / EHEC) GN=ECO111_p1-165 PE=4 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 2.260e-16 Identity = 39/80 (48.75%), Postives = 60/80 (75.00%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ DE LG PFY FHPAQP +SV IDVC+ SDLT+RL+SL+S + + F+++ E+L++++I Sbjct: 231 VIDPKNDAEWRQSLMDEASELGLPFYKFHPAQPSSSVCIDVCNAYTNVSDLTSRLLSLVSVPGEVNPFVQYAEALVSTVI 310
BLAST of FL512450 vs. TrEMBL
Match: A4V9N6_SALPK (Putative coupling protein OS=Salmonella paratyphi A (strain AKU_12601) GN=traG PE=4 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 2.260e-16 Identity = 39/80 (48.75%), Postives = 60/80 (75.00%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ DE LG PFY FHPAQP +SV IDVC+ SDLT+RL+SL+S + + F+++ E+L++++I Sbjct: 231 VIDPKNDAEWRQSLMDEASELGLPFYKFHPAQPSSSVCIDVCNAYTNVSDLTSRLLSLVSVPGEVNPFVQYAEALVSTVI 310
BLAST of FL512450 vs. TrEMBL
Match: Q9L5M3_SALTI (Putative uncharacterized protein traG OS=Salmonella typhi GN=traG PE=4 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 2.260e-16 Identity = 39/80 (48.75%), Postives = 60/80 (75.00%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ DE LG PFY FHPAQP +SV IDVC+ SDLT+RL+SL+S + + F+++ E+L++++I Sbjct: 231 VIDPKNDAEWRQSLMDEASELGLPFYKFHPAQPSSSVCIDVCNAYTNVSDLTSRLLSLVSVPGEVNPFVQYAEALVSTVI 310
BLAST of FL512450 vs. TrEMBL
Match: A8R6R7_SALET (Putative membrane protein OS=Salmonella enterica subsp. enterica serovar Choleraesuis GN=MAK1.155 PE=4 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 2.260e-16 Identity = 39/80 (48.75%), Postives = 60/80 (75.00%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ DE LG PFY FHPAQP +SV IDVC+ SDLT+RL+SL+S + + F+++ E+L++++I Sbjct: 197 VIDPKNDAEWRQSLMDEASELGLPFYKFHPAQPSSSVCIDVCNAYTNVSDLTSRLLSLVSVPGEVNPFVQYAEALVSTVI 276
BLAST of FL512450 vs. TrEMBL
Match: Q19NC9_ECOK1 (TraG OS=Escherichia coli O1:K1 / APEC GN=traG PE=4 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 4.262e-15 Identity = 35/80 (43.75%), Postives = 61/80 (76.25%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ +E ++LG PFY FHP QP +SV IDVC+ SDLT+RL+SL++ + + F+++ ++L++++I Sbjct: 231 VIDPKNDAEWRESLMEEAKTLGLPFYKFHPGQPASSVCIDVCNTYTNVSDLTSRLLSLVTVPGEVNPFVQYAKALVSNVI 310
BLAST of FL512450 vs. TrEMBL
Match: Q6MXI6_SERMA (Membrane protein OS=Serratia marcescens GN=traG PE=4 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 4.262e-15 Identity = 35/80 (43.75%), Postives = 61/80 (76.25%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ +E ++LG PFY FHP QP +SV IDVC+ SDLT+RL+SL++ + + F+++ ++L++++I Sbjct: 231 VIDPKNDAEWRESLMEEAKTLGLPFYKFHPGQPASSVCIDVCNTYTNVSDLTSRLLSLVTVPGEVNPFVQYAKALVSNVI 310
BLAST of FL512450 vs. TrEMBL
Match: C1IUU7_ENTCL (TraG OS=Enterobacter cloacae PE=4 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 4.262e-15 Identity = 35/80 (43.75%), Postives = 61/80 (76.25%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ +E ++LG PFY FHP QP +SV IDVC+ SDLT+RL+SL++ + + F+++ ++L++++I Sbjct: 231 VIDPKNDAEWRESLMEEAKTLGLPFYKFHPGQPASSVCIDVCNTYTNVSDLTSRLLSLVTVPGEVNPFVQYAKALVSNVI 310
BLAST of FL512450 vs. TrEMBL
Match: A7KG52_KLEPN (TraG OS=Klebsiella pneumoniae PE=4 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 4.262e-15 Identity = 35/80 (43.75%), Postives = 61/80 (76.25%), Query Frame = -1 Query: 4 IVDPKNDQDWQKSMRDECESLGKPFYHFHPAQP-TSVSIDVCHNIVKDSDLTNRLISLISSVDDNDGFIRFGESLITSII 240 ++DPKND +W++S+ +E ++LG PFY FHP QP +SV IDVC+ SDLT+RL+SL++ + + F+++ ++L++++I Sbjct: 231 VIDPKNDAEWRESLMEEAKTLGLPFYKFHPGQPASSVCIDVCNTYTNVSDLTSRLLSLVTVPGEVNPFVQYAKALVSNVI 310 The following BLAST results are available for this feature:
BLAST of FL512450 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 9
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FL512450 ID=FL512450; Name=FL512450; organism=Cicer arietinum; type=EST; length=303bpback to top |