DR749499
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR749499 vs. TrEMBL
Match: B9R7Z9_RICCO (Glycosyltransferase, putative OS=Ricinus communis GN=RCOM_1595730 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.188e-7 Identity = 27/38 (71.05%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 13 KRLTWERKGMRKCKEMFLEHHMSHRIALVLKDVLRKAK 126 +RLT + G ++ KE FLEHHMSHRIALVLK+VLRKAK Sbjct: 439 RRLTMGKNGYKRVKERFLEHHMSHRIALVLKEVLRKAK 476
BLAST of DR749499 vs. TAIR peptide
Match: AT1G19710.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr1:6814920-6816716 FORWARD LENGTH=479) HSP 1 Score: 50.8322 bits (120), Expect = 1.987e-7 Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 1 Query: 16 RLTWERKGMRKCKEMFLEHHMSHRIALVLKDVLRKAK 126 R T +KG + KEMFLEHHMSHRIA VL++VL+ AK Sbjct: 433 RNTMGKKGYERVKEMFLEHHMSHRIASVLREVLQHAK 469
BLAST of DR749499 vs. TAIR peptide
Match: AT1G75420.1 (| Symbols: | UDP-Glycosyltransferase superfamily protein | chr1:28305469-28307317 FORWARD LENGTH=463) HSP 1 Score: 50.447 bits (119), Expect = 2.595e-7 Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 16 RLTWERKGMRKCKEMFLEHHMSHRIALVLKDVLRKAK 126 RL + G + KEMFLEHHMSHRIA VLK+VL+ AK Sbjct: 422 RLRMGKNGYERVKEMFLEHHMSHRIASVLKEVLQHAK 458 The following BLAST results are available for this feature:
BLAST of DR749499 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of DR749499 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DR749499 ID=DR749499; Name=DR749499; organism=Cicer arietinum; type=EST; length=267bpback to top |