GR400432
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR400432 vs. TrEMBL
Match: C9YEF0_9BURK (Putative uncharacterized protein OS=Curvibacter putative symbiont of Hydra magnipapillata GN=Csp_D29560 PE=4 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.675e-11 Identity = 33/43 (76.74%), Postives = 36/43 (83.72%), Query Frame = 3 Query: 84 GYPIQKSPEQSKFASSPKLNTGYHVLRRRKSPRHPPHALNHLT 212 G+PI+KSP+QS FASSPKL GYHVLRR PRHPPHAL HLT Sbjct: 125 GFPIRKSPDQSLFASSPKLIAGYHVLRRLSLPRHPPHALIHLT 167
BLAST of GR400432 vs. TrEMBL
Match: A7BNW4_9GAMM (Putative uncharacterized protein OS=Beggiatoa sp. SS GN=BGS_1412 PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.327e-8 Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 3 Query: 84 GYPIQKSPEQSKFASSPKLNTGYHVLRRRKSPRHPPHALNHLTP 215 G+PI+KSP+Q+ FA SPKL YHVL R SPRHPP ALN L P Sbjct: 24 GFPIRKSPDQNLFADSPKLIADYHVLHRLLSPRHPPCALNSLDP 67
BLAST of GR400432 vs. TrEMBL
Match: B1N6K0_9PROT (Putative uncharacterized protein OS=uncultured beta proteobacterium CBNPD1 BAC clone 578 PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 8.602e-8 Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 2 Query: 68 DSSRRGLPHSKISGTKQICQLPKT*HRLSRPSTPEITKASTTCS 199 D+ G PHS+ISG+K ICQLP+ RLSRPS+P I KASTTC+ Sbjct: 6 DTLAGGFPHSEISGSKLICQLPEAYRRLSRPSSPVIAKASTTCT 49
BLAST of GR400432 vs. TrEMBL
Match: B9P7X8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_680477 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.282e-7 Identity = 28/44 (63.64%), Postives = 33/44 (75.00%), Query Frame = 2 Query: 68 DSSRRGLPHSKISGTKQICQLPKT*HRLSRPSTPEITKASTTCS 199 D+ G PHS+ISG+K ICQLP+ RLSR S+P I KASTTCS Sbjct: 6 DTLAGGFPHSEISGSKLICQLPEAYRRLSRLSSPIIAKASTTCS 49 The following BLAST results are available for this feature:
BLAST of GR400432 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR400432 ID=GR400432; Name=GR400432; organism=Cicer arietinum; type=EST; length=218bpback to top |