GO660551

EST Overview
NameGO660551
Unique NameGO660551
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length144
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Swissprot2010-12-28
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of GO660551 vs. SwissProt
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.009e-7
Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 2
Query:   11 QFAVTEYNKQSGKNLKFESVEKGETQVVSGTNYRL 115
            +FAV+EYNK+S   LKFE+V  GETQVVSGTNYRL
Sbjct:   47 EFAVSEYNKRSESGLKFETVVSGETQVVSGTNYRL 81          
BLAST of GO660551 vs. TrEMBL
Match: Q9FQ13_CITPA (Cystatin-like protein OS=Citrus paradisi PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.520e-9
Identity = 32/35 (91.43%), Postives = 32/35 (91.43%), Query Frame = 2
Query:   11 QFAVTEYNKQSGKNLKFESVEKGETQVVSGTNYRL 115
            QFAVTEYNKQS   LKFESVEKGETQVVSGTNYRL
Sbjct:   48 QFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRL 82          
BLAST of GO660551 vs. TrEMBL
Match: A5B2E1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_013491 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 9.585e-7
Identity = 26/35 (74.29%), Postives = 32/35 (91.43%), Query Frame = 2
Query:   11 QFAVTEYNKQSGKNLKFESVEKGETQVVSGTNYRL 115
            +FAVTE+NKQ+ ++LKF+SV  GETQVVSGTNYRL
Sbjct:   50 EFAVTEHNKQAXESLKFQSVVSGETQVVSGTNYRL 84          
BLAST of GO660551 vs. TAIR peptide
Match: AT5G47550.1 (| Symbols: | Cystatin/monellin superfamily protein | chr5:19286596-19286964 REVERSE LENGTH=122)

HSP 1 Score: 55.4546 bits (132), Expect = 8.039e-9
Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 2
Query:   11 QFAVTEYNKQSGKNLKFESVEKGETQVVSGTNYRL 115
            +FAV+EYNK+S   LKFE+V  GETQVVSGTNYRL
Sbjct:   47 EFAVSEYNKRSESGLKFETVVSGETQVVSGTNYRL 81          
The following BLAST results are available for this feature:
BLAST of GO660551 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 1
Match NameE-valueIdentityDescription
CYT5_ARATH1.009e-774.29Cysteine proteinase inhibitor 5 OS=Arabidopsis tha... [more]
back to top
BLAST of GO660551 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 2
Match NameE-valueIdentityDescription
Q9FQ13_CITPA3.520e-991.43Cystatin-like protein OS=Citrus paradisi PE=4 SV=1[more]
A5B2E1_VITVI9.585e-774.29Putative uncharacterized protein OS=Vitis vinifera... [more]
back to top
BLAST of GO660551 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT5G47550.18.039e-974.29| Symbols: | Cystatin/monellin superfamily protei... [more]
back to top
Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GO660551 ID=GO660551|Name=GO660551|organism=Cicer arietinum|type=EST|length=144bp
GACTGCGTACCAGTTCGCGGTGACGGAGTACAACAAACAGTCAGGTAAGA
ATTTGAAGTTCGAGAGCGTGGAGAAGGGCGAGACTCAGGTGGTTTCCGGA
ACAAACTACCGTCTCTTTTGTTGACTGTTACTCAGGACTCATCA
back to top