GO660551
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GO660551 vs. SwissProt
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 55.4546 bits (132), Expect = 1.009e-7 Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 11 QFAVTEYNKQSGKNLKFESVEKGETQVVSGTNYRL 115 +FAV+EYNK+S LKFE+V GETQVVSGTNYRL Sbjct: 47 EFAVSEYNKRSESGLKFETVVSGETQVVSGTNYRL 81
BLAST of GO660551 vs. TrEMBL
Match: Q9FQ13_CITPA (Cystatin-like protein OS=Citrus paradisi PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.520e-9 Identity = 32/35 (91.43%), Postives = 32/35 (91.43%), Query Frame = 2 Query: 11 QFAVTEYNKQSGKNLKFESVEKGETQVVSGTNYRL 115 QFAVTEYNKQS LKFESVEKGETQVVSGTNYRL Sbjct: 48 QFAVTEYNKQSKSALKFESVEKGETQVVSGTNYRL 82
BLAST of GO660551 vs. TrEMBL
Match: A5B2E1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_013491 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.585e-7 Identity = 26/35 (74.29%), Postives = 32/35 (91.43%), Query Frame = 2 Query: 11 QFAVTEYNKQSGKNLKFESVEKGETQVVSGTNYRL 115 +FAVTE+NKQ+ ++LKF+SV GETQVVSGTNYRL Sbjct: 50 EFAVTEHNKQAXESLKFQSVVSGETQVVSGTNYRL 84
BLAST of GO660551 vs. TAIR peptide
Match: AT5G47550.1 (| Symbols: | Cystatin/monellin superfamily protein | chr5:19286596-19286964 REVERSE LENGTH=122) HSP 1 Score: 55.4546 bits (132), Expect = 8.039e-9 Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 11 QFAVTEYNKQSGKNLKFESVEKGETQVVSGTNYRL 115 +FAV+EYNK+S LKFE+V GETQVVSGTNYRL Sbjct: 47 EFAVSEYNKRSESGLKFETVVSGETQVVSGTNYRL 81 The following BLAST results are available for this feature:
BLAST of GO660551 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of GO660551 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of GO660551 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GO660551 ID=GO660551; Name=GO660551; organism=Cicer arietinum; type=EST; length=144bpback to top |