CD051350
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CD051350 vs. TrEMBL
Match: Q43469_HELAN (Delta-8 sphingolipid desaturase OS=Helianthus annuus GN=sld1 PE=2 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.223e-7 Identity = 26/32 (81.25%), Postives = 28/32 (87.50%), Query Frame = -3 Query: 97 TLKTLRTAALQARDMVDPXAQNLLWEAFNTHG 192 TLKTLRTAALQARD+ +P QNL WEAFNTHG Sbjct: 427 TLKTLRTAALQARDLTNPAPQNLAWEAFNTHG 458
BLAST of CD051350 vs. TAIR peptide
Match: AT2G46210.1 (| Symbols: | Fatty acid/sphingolipid desaturase | chr2:18977542-18978891 FORWARD LENGTH=449) HSP 1 Score: 53.1434 bits (126), Expect = 4.009e-8 Identity = 21/34 (61.76%), Postives = 28/34 (82.35%), Query Frame = -3 Query: 97 LWTLKTLRTAALQARDMVDPXAQNLLWEAFNTHG 198 +WT++TL+ AA+QARD +P +NLLWEA NTHG Sbjct: 416 VWTIRTLKNAAIQARDATNPVLKNLLWEAVNTHG 449
BLAST of CD051350 vs. TAIR peptide
Match: AT3G61580.1 (| Symbols: | Fatty acid/sphingolipid desaturase | chr3:22786253-22787602 FORWARD LENGTH=449) HSP 1 Score: 48.9062 bits (115), Expect = 7.561e-7 Identity = 20/32 (62.50%), Postives = 26/32 (81.25%), Query Frame = -3 Query: 97 TLKTLRTAALQARDMVDPXAQNLLWEAFNTHG 192 T+ TL+TAA QARD+ +P +NL+WEA NTHG Sbjct: 418 TINTLKTAAYQARDVANPVVKNLVWEALNTHG 449 The following BLAST results are available for this feature:
BLAST of CD051350 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of CD051350 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CD051350 ID=CD051350; Name=CD051350; organism=Cicer arietinum; type=EST; length=227bpback to top |