HO062959
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO062959 vs. TrEMBL
Match: Q8L5Q7_CICAR (Putative quinone oxidoreductase OS=Cicer arietinum GN=qor PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.317e-7 Identity = 27/39 (69.23%), Postives = 30/39 (76.92%), Query Frame = -3 Query: 10 EKGKGGSPYGSGTYAGEGSRQPRELEWAQLFIRGSACRG 126 EK KGGSPYG+GTYAG+GSRQP ELE AQ F +G G Sbjct: 157 EKVKGGSPYGAGTYAGDGSRQPTELELAQAFHQGKYFAG 195
BLAST of HO062959 vs. TrEMBL
Match: C6T2H1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.317e-7 Identity = 27/39 (69.23%), Postives = 30/39 (76.92%), Query Frame = -3 Query: 10 EKGKGGSPYGSGTYAGEGSRQPRELEWAQLFIRGSACRG 126 EK KGGSPYG+GTYAG+GSRQP ELE AQ F +G G Sbjct: 156 EKVKGGSPYGAGTYAGDGSRQPSELELAQAFHQGKYFAG 194
BLAST of HO062959 vs. TAIR peptide
Match: AT4G27270.1 (| Symbols: | Quinone reductase family protein | chr4:13661458-13663243 REVERSE LENGTH=205) HSP 1 Score: 51.6026 bits (122), Expect = 1.191e-7 Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = -3 Query: 25 EKGKGGSPYGSGTYAGEGSRQPRELEWAQLFIRG 126 E KGGSPYG+GT+AG+GSRQP ELE Q F +G Sbjct: 156 ENVKGGSPYGAGTFAGDGSRQPTELELGQAFHQG 189
BLAST of HO062959 vs. TAIR peptide
Match: AT5G54500.1 (| Symbols: FQR1 | flavodoxin-like quinone reductase 1 | chr5:22124674-22126256 FORWARD LENGTH=204) HSP 1 Score: 51.2174 bits (121), Expect = 1.556e-7 Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = -3 Query: 25 EKGKGGSPYGSGTYAGEGSRQPRELEWAQLFIRG 126 E KGGSPYG+GT+AG+GSRQP ELE Q F +G Sbjct: 156 ENVKGGSPYGAGTFAGDGSRQPTELELQQAFHQG 189 The following BLAST results are available for this feature:
BLAST of HO062959 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of HO062959 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO062959 ID=HO062959; Name=HO062959; organism=Cicer arietinum; type=EST; length=245bpback to top |