CD766041

EST Overview
NameCD766041
Unique NameCD766041
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length102
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Swissprot2010-12-28
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
Libraries
Library NameType
LIBEST_013933 chickpea leaf cDNA-AFLP fragmentscdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of CD766041 vs. SwissProt
Match: CHLD_PEA (Magnesium-chelatase subunit chlD, chloroplastic OS=Pisum sativum GN=CHLD PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.910e-9
Identity = 30/31 (96.77%), Postives = 30/31 (96.77%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGDS EVLLPPSR
Sbjct:  576 KLLAESYTSRDQVSIIPFRGDSAEVLLPPSR 606          
BLAST of CD766041 vs. SwissProt
Match: CHLD_ARATH (Magnesium-chelatase subunit chlD, chloroplastic OS=Arabidopsis thaliana GN=CHLD PE=2 SV=3)

HSP 1 Score: 60.077 bits (144), Expect = 4.255e-9
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGD+ EVLLPPSR
Sbjct:  583 KLLAESYTSRDQVSIIPFRGDAAEVLLPPSR 613          
BLAST of CD766041 vs. SwissProt
Match: CHLD_TOBAC (Magnesium-chelatase subunit chlD, chloroplastic OS=Nicotiana tabacum GN=CHLD PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.617e-8
Identity = 28/31 (90.32%), Postives = 29/31 (93.55%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQV IIPFRGD+ EVLLPPSR
Sbjct:  581 KLLAESYTSRDQVCIIPFRGDAAEVLLPPSR 611          
BLAST of CD766041 vs. TrEMBL
Match: Q93YN7_ARATH (Similar to magnesium-chelatase subunit ChlD OS=Arabidopsis thaliana GN=T27G7.20 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 8.680e-8
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGD+ EVLLPPSR
Sbjct:  294 KLLAESYTSRDQVSIIPFRGDAAEVLLPPSR 324          
BLAST of CD766041 vs. TrEMBL
Match: D7SNG8_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_61.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00031555001 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 8.680e-8
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQV+IIPFRGDS EVLLPPSR
Sbjct:  427 KLLAESYTSRDQVAIIPFRGDSAEVLLPPSR 457          
BLAST of CD766041 vs. TrEMBL
Match: D7KIS8_ARALY (T27G7.20 OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_311903 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 8.680e-8
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGD+ EVLLPPSR
Sbjct:  595 KLLAESYTSRDQVSIIPFRGDAAEVLLPPSR 625          
BLAST of CD766041 vs. TrEMBL
Match: B9RIG5_RICCO (Magnesium-chelatase subunit chlD, chloroplast, putative OS=Ricinus communis GN=RCOM_1578810 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 8.680e-8
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQV+IIPFRGDS EVLLPPSR
Sbjct:  584 KLLAESYTSRDQVAIIPFRGDSAEVLLPPSR 614          
BLAST of CD766041 vs. TrEMBL
Match: Q7XZG7_ORYSJ (Putative magnesium chelatase subunit chlD OS=Oryza sativa subsp. japonica GN=OSJNBb0033J23.6 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.934e-7
Identity = 29/31 (93.55%), Postives = 29/31 (93.55%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGD  EVLLPPSR
Sbjct:  569 KLLAESYTSRDQVSIIPFRGDFAEVLLPPSR 599          
BLAST of CD766041 vs. TrEMBL
Match: Q6ATS0_ORYSJ (Magnesium chelatase ATPase subunit D family protein, expressed OS=Oryza sativa subsp. japonica GN=OSJNBa0028F23.2 PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.934e-7
Identity = 29/31 (93.55%), Postives = 29/31 (93.55%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGD  EVLLPPSR
Sbjct:  578 KLLAESYTSRDQVSIIPFRGDFAEVLLPPSR 608          
BLAST of CD766041 vs. TrEMBL
Match: C5WW04_SORBI (Putative uncharacterized protein Sb01g003860 OS=Sorghum bicolor GN=Sb01g003860 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.934e-7
Identity = 29/31 (93.55%), Postives = 29/31 (93.55%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGD  EVLLPPSR
Sbjct:  577 KLLAESYTSRDQVSIIPFRGDYAEVLLPPSR 607          
BLAST of CD766041 vs. TrEMBL
Match: B9HP09_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_1088048 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.934e-7
Identity = 28/31 (90.32%), Postives = 30/31 (96.77%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQV+IIPFRGD+ EVLLPPSR
Sbjct:  609 KLLAESYTSRDQVAIIPFRGDAAEVLLPPSR 639          
BLAST of CD766041 vs. TrEMBL
Match: B8AMB8_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_14020 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.934e-7
Identity = 29/31 (93.55%), Postives = 29/31 (93.55%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGD  EVLLPPSR
Sbjct:  578 KLLAESYTSRDQVSIIPFRGDFAEVLLPPSR 608          
BLAST of CD766041 vs. TrEMBL
Match: Q9SMF0_HORVU (Mg-protoporphyrin IX (Fragment) OS=Hordeum vulgare GN=xantha-g PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.308e-7
Identity = 28/31 (90.32%), Postives = 29/31 (93.55%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQV+IIPFRGD  EVLLPPSR
Sbjct:  198 KLLAESYTSRDQVAIIPFRGDYAEVLLPPSR 228          
BLAST of CD766041 vs. TAIR peptide
Match: AT1G08520.1 (| Symbols: ALB1, ALB-1V, V157, PDE166, CHLD | ALBINA 1 | chr1:2696538-2700819 FORWARD LENGTH=760)

HSP 1 Score: 60.077 bits (144), Expect = 3.235e-10
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = -1
Query:    1 KLLAESYTSRDQVSIIPFRGDSXEVLLPPSR 93
            KLLAESYTSRDQVSIIPFRGD+ EVLLPPSR
Sbjct:  583 KLLAESYTSRDQVSIIPFRGDAAEVLLPPSR 613          
The following BLAST results are available for this feature:
BLAST of CD766041 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 3
Match NameE-valueIdentityDescription
CHLD_PEA1.910e-996.77Magnesium-chelatase subunit chlD, chloroplastic OS... [more]
CHLD_ARATH4.255e-993.55Magnesium-chelatase subunit chlD, chloroplastic OS... [more]
CHLD_TOBAC1.617e-890.32Magnesium-chelatase subunit chlD, chloroplastic OS... [more]
back to top
BLAST of CD766041 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q93YN7_ARATH8.680e-893.55Similar to magnesium-chelatase subunit ChlD OS=Ara... [more]
D7SNG8_VITVI8.680e-893.55Whole genome shotgun sequence of line PN40024, sca... [more]
D7KIS8_ARALY8.680e-893.55T27G7.20 OS=Arabidopsis lyrata subsp. lyrata GN=AR... [more]
B9RIG5_RICCO8.680e-893.55Magnesium-chelatase subunit chlD, chloroplast, put... [more]
Q7XZG7_ORYSJ1.934e-793.55Putative magnesium chelatase subunit chlD OS=Oryza... [more]
Q6ATS0_ORYSJ1.934e-793.55Magnesium chelatase ATPase subunit D family protei... [more]
C5WW04_SORBI1.934e-793.55Putative uncharacterized protein Sb01g003860 OS=So... [more]
B9HP09_POPTR1.934e-790.32Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B8AMB8_ORYSI1.934e-793.55Putative uncharacterized protein OS=Oryza sativa s... [more]
Q9SMF0_HORVU4.308e-790.32Mg-protoporphyrin IX (Fragment) OS=Hordeum vulgare... [more]
back to top
BLAST of CD766041 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 1
Match NameE-valueIdentityDescription
AT1G08520.13.235e-1093.55| Symbols: ALB1, ALB-1V, V157, PDE166, CHLD | ALBI... [more]
back to top
Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD766041 ID=CD766041|Name=CD766041|organism=Cicer arietinum|type=EST|length=102bp
TCTAGAAGGTGGCAGTAGAACTTCANCCGAATCTCCACGGAATGGAATTA
TAGATACCTGATCCCTGCTTGTGTAACTTTCTGCCAGAAGCTTACTCAGG
AC
back to top