FE671359

EST Overview
NameFE671359
Unique NameFE671359
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length611
Libraries
Library NameType
LIBEST_022820 Drought-stressed chickpea leave librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of FE671359 vs. SwissProt
Match: ODPB_CHAGL (Pyruvate dehydrogenase E1 component subunit beta OS=Chaetosphaeridium globosum GN=pdhB PE=3 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.163e-84
Identity = 150/200 (75.00%), Postives = 171/200 (85.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD SV VMGEDVGHYGGSYKVT+   EK+GDLR+LDTPIAEN+FTGM IGAAMTGLRPIVEGMNMGFLLLAFNQI+NN GMLHYTSGG FK             QLGAEHSQRLESYFQS+PG+QMVACSTPYN KGL+K+AIR+DNPVI FEHVLLYNL E + ++EY+L LE+AE+VRPG  +TILTYS+MR+HV+Q
Sbjct:   19 QRDPSVLVMGEDVGHYGGSYKVTKGFHEKYGDLRLLDTPIAENSFTGMAIGAAMTGLRPIVEGMNMGFLLLAFNQIANNAGMLHYTSGGNFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSVPGLQMVACSTPYNGKGLLKSAIRNDNPVIFFEHVLLYNLNENLIEQEYLLCLEKAEVVRPGNDITILTYSRMRHHVLQ 218          
BLAST of FE671359 vs. SwissProt
Match: ODPB_ZYGCR (Pyruvate dehydrogenase E1 component subunit beta OS=Zygnema circumcarinatum GN=pdhB PE=3 SV=2)

HSP 1 Score: 311.612 bits (797), Expect = 1.983e-84
Identity = 149/200 (74.50%), Postives = 173/200 (86.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  V VMGEDVGHYGGSYKVT+  AE++GDLR+LDTPIAEN+FTGM IGAAMTGLRP+VEGMNMGFLLLAFNQI+NN GMLHYTSGG F              QLGAEHSQRLESYFQS+PG+QMVACSTPYNAKGL+K+AIRSDNP+ILFEHVLLYNLKE + +EEY++ LE+AE+VRPG  +TILTYS+MR++V+Q
Sbjct:   19 DRDPRVMVMGEDVGHYGGSYKVTKGFAERYGDLRLLDTPIAENSFTGMAIGAAMTGLRPVVEGMNMGFLLLAFNQIANNAGMLHYTSGGNFTIPIVIRGPGGVGRQLGAEHSQRLESYFQSVPGLQMVACSTPYNAKGLIKSAIRSDNPIILFEHVLLYNLKEDLAEEEYLVCLEKAEVVRPGNDITILTYSRMRHNVLQ 218          
BLAST of FE671359 vs. SwissProt
Match: ODPB_STAPU (Pyruvate dehydrogenase E1 component subunit beta OS=Staurastrum punctulatum GN=pdhB PE=3 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 4.419e-84
Identity = 149/200 (74.50%), Postives = 171/200 (85.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  V VMGEDVGHYGGSYKVT+  AEK+GDLR+LDTPIAEN+FTGM IGAAMTGLRP+VEGMNMGFLLLAFNQI+NN GMLHYTSG  F              QLGAEHSQRLESYFQS+PG+Q+VACSTP NAKGL+K++IRS+NPVILFEHVLLYNLKE IPD EY++ LE+AE+VRPG  +TILTYS+MR+HV+Q
Sbjct:   19 DRDPKVLVMGEDVGHYGGSYKVTKGFAEKYGDLRLLDTPIAENSFTGMAIGAAMTGLRPVVEGMNMGFLLLAFNQIANNAGMLHYTSGANFTIPIVIRGPGGVGRQLGAEHSQRLESYFQSVPGLQLVACSTPINAKGLIKSSIRSENPVILFEHVLLYNLKETIPDNEYLVCLEKAEIVRPGTDITILTYSRMRHHVLQ 218          
BLAST of FE671359 vs. SwissProt
Match: ODPB_CHAVU (Pyruvate dehydrogenase E1 component subunit beta OS=Chara vulgaris GN=pdhB PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.679e-83
Identity = 146/200 (73.00%), Postives = 170/200 (85.00%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            ERD  V V+GED+GHYGGSYKVT+ L EK+G+LR+LDTPIAEN+FTG+ IGAAMTGLRPI+EGMNMGFLLLAFNQI+NN GMLHYTSGG F              QLGAEHSQRLESYFQS+PG+QMVACSTPYNAKGL+K+AIRS NP+I FEHVLLYN+KE IP +EY++ LE+AE+VR G  +TILTYS+MRYHV+Q
Sbjct:   19 ERDPKVFVIGEDIGHYGGSYKVTKGLFEKYGNLRILDTPIAENSFTGIAIGAAMTGLRPIIEGMNMGFLLLAFNQIANNAGMLHYTSGGNFTTPLVVRGPGGVGRQLGAEHSQRLESYFQSVPGLQMVACSTPYNAKGLIKSAIRSQNPIIFFEHVLLYNIKENIPQKEYLVPLEKAELVRSGNQITILTYSRMRYHVLQ 218          
BLAST of FE671359 vs. SwissProt
Match: ODPB_PORPU (Pyruvate dehydrogenase E1 component subunit beta OS=Porphyra purpurea GN=pdhB PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.738e-80
Identity = 141/200 (70.50%), Postives = 171/200 (85.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            E+D +VCV+GEDVGHYGGSYKVT++L  K+GDLRVLDTPIAEN+FTGM IGAA+TGLRPIVEGMNM FLLLAFNQISNN GML YTSGG F              QLGAEHSQRLE+YFQ+IPG+++VACSTPYNAKGL+K+AIR +NPV+ FEHVLLYNL+E IP++EY++ L++AE+VR G+ +TILTYS+MR+HV +
Sbjct:   19 EKDLTVCVIGEDVGHYGGSYKVTKDLHSKYGDLRVLDTPIAENSFTGMAIGAAITGLRPIVEGMNMSFLLLAFNQISNNAGMLRYTSGGNFTLPLVIRGPGGVGRQLGAEHSQRLEAYFQAIPGLKIVACSTPYNAKGLLKSAIRDNNPVVFFEHVLLYNLQEEIPEDEYLIPLDKAEVVRKGKDITILTYSRMRHHVTE 218          
BLAST of FE671359 vs. SwissProt
Match: ODPB_PORYE (Pyruvate dehydrogenase E1 component subunit beta OS=Porphyra yezoensis GN=pdhB PE=3 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 8.624e-80
Identity = 142/199 (71.36%), Postives = 166/199 (83.42%), Query Frame = 3
Query:   15 RDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +D +VCV+GEDVGHYGGSYKVT++L  K+GDLRVLDTPIAEN+FTGM IGAA+TGLRPIVEGMNM FLLLAFNQISNN GML YTSGG F              QLGAEHSQRLE+YFQ+IPG+++VACSTPYNAKGL+K+AIR +NPV+ FEHVLLYNL+E IP EEY L L + E VR G+ +TILTYS+MR+HV+Q
Sbjct:   20 KDPTVCVIGEDVGHYGGSYKVTKDLHSKYGDLRVLDTPIAENSFTGMAIGAAITGLRPIVEGMNMSFLLLAFNQISNNAGMLRYTSGGNFTLPLVIRGPGGVGRQLGAEHSQRLEAYFQAIPGLKIVACSTPYNAKGLLKSAIRDNNPVVFFEHVLLYNLQEEIPQEEYFLPLNKVEFVRKGKDITILTYSRMRHHVIQ 218          
BLAST of FE671359 vs. SwissProt
Match: ODPB_GRATL (Pyruvate dehydrogenase E1 component subunit beta OS=Gracilaria tenuistipitata var. liui GN=pdhB PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 1.921e-79
Identity = 142/200 (71.00%), Postives = 169/200 (84.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            + D+SV ++GEDVGHYGGSYKVT++L  K+GDLRVLDTPIAEN+F GM IGAA+TGLRPIVEGMNM FLLLAFNQISNN GML YTSGG F+             QLGAEHSQRLE+YFQ+IPG+++VACSTPYNAKGL+K+AIR +NPVI FEHVLLYNLK+ +P++EY L L++AE+VR G  VTILTYS+MR+HVMQ
Sbjct:   19 QNDSSVFILGEDVGHYGGSYKVTKDLHSKYGDLRVLDTPIAENSFMGMAIGAAITGLRPIVEGMNMSFLLLAFNQISNNAGMLRYTSGGNFQIPIVIRGPGGVGRQLGAEHSQRLEAYFQAIPGLKIVACSTPYNAKGLLKSAIRDNNPVIFFEHVLLYNLKDELPNDEYFLPLDKAELVRDGLDVTILTYSRMRHHVMQ 218          
BLAST of FE671359 vs. SwissProt
Match: ODPB_CYAME (Pyruvate dehydrogenase E1 component subunit beta OS=Cyanidioschyzon merolae GN=pdhB PE=3 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 3.067e-77
Identity = 137/199 (68.84%), Postives = 164/199 (82.41%), Query Frame = 3
Query:   15 RDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            RD  V V+GEDVGHYGGSYKVT+ L  K+GDLRVLDTPIAEN+FTGM IGAAMTGL+P+VEGMN+ FLLLAFNQISNN GMLHYTSGG +              QL AEHSQR+E+YFQ++PG+++VACSTPYNAKGL+KAAIR +NPV+  EHVLLYNLK+ IP +EYVL L++A++VR G  VTI+TYS+M +HVMQ
Sbjct:   21 RDKRVFVLGEDVGHYGGSYKVTKQLHTKYGDLRVLDTPIAENSFTGMAIGAAMTGLKPVVEGMNLSFLLLAFNQISNNAGMLHYTSGGNWSIPLVIRGPGGIGKQLSAEHSQRIEAYFQAVPGLKIVACSTPYNAKGLLKAAIRDNNPVLFLEHVLLYNLKQEIPKQEYVLPLDKAQVVREGSDVTIITYSRMLHHVMQ 219          
BLAST of FE671359 vs. SwissProt
Match: ODPB_CYACA (Pyruvate dehydrogenase E1 component subunit beta OS=Cyanidium caldarium GN=pdhB PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.174e-74
Identity = 136/198 (68.69%), Postives = 159/198 (80.30%), Query Frame = 3
Query:   15 RDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVM 608
            +D++V ++GEDVGHYGGSYKVT++L  K+GDLRVLD PIAEN+FTGM IGAAMTGLRPIVEGMNMGF+LLAFNQISNN  ML YTSGG F              QL AEHSQRLES FQSIPG+Q+VACST YNAKGL+K+AI    P++  EHVLLYNLK  +PDEEY L L++AE+VR G  VTI+TYS+MRYHV+
Sbjct:   20 KDSNVFIVGEDVGHYGGSYKVTKDLHVKYGDLRVLDAPIAENSFTGMAIGAAMTGLRPIVEGMNMGFMLLAFNQISNNLSMLQYTSGGNFNIPVVIRGPGGIGKQLAAEHSQRLESCFQSIPGLQIVACSTAYNAKGLLKSAIIEKKPILFLEHVLLYNLKGFVPDEEYYLPLDKAEVVRSGSDVTIVTYSRMRYHVL 217          
BLAST of FE671359 vs. SwissProt
Match: ODPB_MESVI (Pyruvate dehydrogenase E1 component subunit beta OS=Mesostigma viride GN=pdhB PE=3 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.334e-72
Identity = 131/199 (65.83%), Postives = 158/199 (79.40%), Query Frame = 3
Query:   15 RDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            R+  V ++GED+GHYGGSYKVT+NL  K+G+ RV+DTPIAEN+F G  IGAAMTGL  +VEGMNMGF+LLAF+QISNN GML  TSGG +              QLGAEHSQRLE YFQS+PG+Q+VACSTPYNAKGL+K+AIRS NP+   EHVLLYNLK  +PD +YVL LE+AE+VR G  +TILTYS+MRY+V+Q
Sbjct:   20 RNDKVALLGEDIGHYGGSYKVTQNLYAKYGEHRVIDTPIAENSFVGAAIGAAMTGLVTVVEGMNMGFILLAFSQISNNMGMLSATSGGHYHIPIVLRGPGGVGKQLGAEHSQRLECYFQSVPGLQIVACSTPYNAKGLLKSAIRSKNPIFFLEHVLLYNLKAEVPDNDYVLPLEKAEIVRQGNDITILTYSRMRYNVIQ 218          
BLAST of FE671359 vs. TrEMBL
Match: C6TMA9_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 6.966e-98
Identity = 178/200 (89.00%), Postives = 183/200 (91.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            ERD  VCVMGEDVGHYGGSYKVT+ LA KFGDLRVLDTPIAEN+FTGMGIGAAMTGLRP+VEGMNMGFLLLAFNQISNNCGMLHYTSGGQFK             QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYS+MRYHVMQ
Sbjct:  100 ERDPCVCVMGEDVGHYGGSYKVTKGLATKFGDLRVLDTPIAENSFTGMGIGAAMTGLRPVVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSRMRYHVMQ 299          
BLAST of FE671359 vs. TrEMBL
Match: C6TDD9_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.552e-97
Identity = 178/200 (89.00%), Postives = 182/200 (91.00%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            ERD  VCVMGEDVGHYGGSYKVT+ LA KFGDLRVLDTPIAENAF GMGIGAAMTGLRP+VEGMNMGFLLLAFNQISNNCGMLHYTSGGQFK             QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYS+MRYHVMQ
Sbjct:   98 ERDPCVCVMGEDVGHYGGSYKVTKGLAPKFGDLRVLDTPIAENAFMGMGIGAAMTGLRPVVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSRMRYHVMQ 297          
BLAST of FE671359 vs. TrEMBL
Match: B5LAW3_CAPAN (Putative pyruvate dehydrogenase E1 beta subunit OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 1.314e-96
Identity = 175/200 (87.50%), Postives = 183/200 (91.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD +VCVMGEDVGHYGGSYKVT+ LA K+GDLRVLDTPIAEN+FTGMGIGAAMTGLRP+VEGMNMGFLLLAFNQISNNCGMLHYTSGGQFK             QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERI DEEYVL+LEEAEMVRPGEHVTILTYS+MRYHVMQ
Sbjct:  103 DRDPTVCVMGEDVGHYGGSYKVTKGLAPKYGDLRVLDTPIAENSFTGMGIGAAMTGLRPVVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIQDEEYVLNLEEAEMVRPGEHVTILTYSRMRYHVMQ 302          
BLAST of FE671359 vs. TrEMBL
Match: B9S0Z5_RICCO (Pyruvate dehydrogenase, putative OS=Ricinus communis GN=RCOM_0632150 PE=4 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 2.241e-96
Identity = 173/200 (86.50%), Postives = 183/200 (91.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD +VCVMGEDVGHYGGSYKVT+ LA KFGDLRVLDTPIAEN+FTGMGIGAAMTGLRP+VEGMNMGFLLLAFNQISNNCGMLHYTSGGQFK             QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKERIPDE+Y+ +LEEAEMVRPGEHVTILTYS+MRYHVMQ
Sbjct:  104 DRDPTVCVMGEDVGHYGGSYKVTKGLATKFGDLRVLDTPIAENSFTGMGIGAAMTGLRPVVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKERIPDEDYICNLEEAEMVRPGEHVTILTYSRMRYHVMQ 303          
BLAST of FE671359 vs. TrEMBL
Match: A9P9K0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_714482 PE=2 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 3.823e-96
Identity = 173/200 (86.50%), Postives = 182/200 (91.00%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  VCVMGEDVGHYGGSYKVT+ LAEK+GDLRVLDTPIAEN+FTGMGIGAAMTGLRPI+EGMNMGFLLLAFNQISNNCGMLHYTSGGQF              QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKERIPDEEY+ +LEEAEMVRPGEHVTILTYS+MRYHVMQ
Sbjct:  110 DRDLHVCVMGEDVGHYGGSYKVTKGLAEKYGDLRVLDTPIAENSFTGMGIGAAMTGLRPIIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKERIPDEEYICNLEEAEMVRPGEHVTILTYSRMRYHVMQ 309          
BLAST of FE671359 vs. TrEMBL
Match: B9IJS2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_668506 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 8.516e-96
Identity = 172/200 (86.00%), Postives = 182/200 (91.00%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  VCVMGEDVGHYGGSYKVT+ LA+K+GDLRVLDTPIAEN+FTGMGIGAAMTGLRPI+EGMNMGFLLLAFNQISNNCGMLHYTSGGQF              QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKERIPDEEY+ +LEEAEMVRPGEHVTILTYS+MRYHVMQ
Sbjct:  106 DRDPHVCVMGEDVGHYGGSYKVTKGLADKYGDLRVLDTPIAENSFTGMGIGAAMTGLRPIIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKERIPDEEYICNLEEAEMVRPGEHVTILTYSRMRYHVMQ 305          
BLAST of FE671359 vs. TrEMBL
Match: Q9C6Z3_ARATH (At1g30120/T2H7_8 OS=Arabidopsis thaliana GN=At1g30120 PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 3.236e-95
Identity = 170/200 (85.00%), Postives = 181/200 (90.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  VCVMGEDVGHYGGSYKVT+ LA+KFGDLRVLDTPI ENAFTGMGIGAAMTGLRP++EGMNMGFLLLAFNQISNNCGMLHYTSGGQF              QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKE+IPDE+YV +LEEAEMVRPGEH+TILTYS+MRYHVMQ
Sbjct:  101 DRDPHVCVMGEDVGHYGGSYKVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKEKIPDEDYVCNLEEAEMVRPGEHITILTYSRMRYHVMQ 300          
BLAST of FE671359 vs. TrEMBL
Match: O64688_ARATH (At2g34590 OS=Arabidopsis thaliana GN=At2g34590 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.226e-95
Identity = 170/200 (85.00%), Postives = 180/200 (90.00%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  VCVMGEDVGHYGGSYKVT+ LA+KFGDLRVLDTPI ENAFTGMGIGAAMTGLRP++EGMNMGFLLLAFNQISNNCGMLHYTSGGQF              QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKE IPDEEY+ +LEEAEMVRPGEH+TILTYS+MRYHVMQ
Sbjct:  101 DRDPHVCVMGEDVGHYGGSYKVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKESIPDEEYICNLEEAEMVRPGEHITILTYSRMRYHVMQ 300          
BLAST of FE671359 vs. TrEMBL
Match: O24458_ARATH (Pyruvate dehydrogenase E1 beta subunit OS=Arabidopsis thaliana PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.226e-95
Identity = 169/200 (84.50%), Postives = 181/200 (90.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  VCVMGEDVGHYGGSYKVT+ LA+KFGDLRVLDTPI ENAFTGMGIGAAMTGLRP++EGMNMGFLLLAFNQISNNCGMLHYTSGGQF              QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKE+IPDE+Y+ +LEEAEMVRPGEH+TILTYS+MRYHVMQ
Sbjct:  101 DRDPHVCVMGEDVGHYGGSYKVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKEKIPDEDYICNLEEAEMVRPGEHITILTYSRMRYHVMQ 300          
BLAST of FE671359 vs. TrEMBL
Match: D7LH23_ARALY (Transketolase family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_482422 PE=4 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.226e-95
Identity = 170/200 (85.00%), Postives = 180/200 (90.00%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  VCVMGEDVGHYGGSYKVT+ LA+KFGDLRVLDTPI ENAFTGMGIGAAMTGLRP++EGMNMGFLLLAFNQISNNCGMLHYTSGGQF              QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKE IPDEEY+ +LEEAEMVRPGEH+TILTYS+MRYHVMQ
Sbjct:  104 DRDPHVCVMGEDVGHYGGSYKVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKETIPDEEYICNLEEAEMVRPGEHITILTYSRMRYHVMQ 303          
BLAST of FE671359 vs. TAIR peptide
Match: AT1G30120.1 (| Symbols: PDH-E1 BETA | pyruvate dehydrogenase E1 beta | chr1:10584350-10586477 REVERSE LENGTH=406)

HSP 1 Score: 351.288 bits (900), Expect = 2.383e-97
Identity = 170/200 (85.00%), Postives = 181/200 (90.50%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  VCVMGEDVGHYGGSYKVT+ LA+KFGDLRVLDTPI ENAFTGMGIGAAMTGLRP++EGMNMGFLLLAFNQISNNCGMLHYTSGGQF              QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKE+IPDE+YV +LEEAEMVRPGEH+TILTYS+MRYHVMQ
Sbjct:  101 DRDPHVCVMGEDVGHYGGSYKVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKEKIPDEDYVCNLEEAEMVRPGEHITILTYSRMRYHVMQ 300          
BLAST of FE671359 vs. TAIR peptide
Match: AT2G34590.1 (| Symbols: | Transketolase family protein | chr2:14568956-14570844 REVERSE LENGTH=406)

HSP 1 Score: 350.903 bits (899), Expect = 3.112e-97
Identity = 170/200 (85.00%), Postives = 180/200 (90.00%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYNLKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKMRYHVMQ 611
            +RD  VCVMGEDVGHYGGSYKVT+ LA+KFGDLRVLDTPI ENAFTGMGIGAAMTGLRP++EGMNMGFLLLAFNQISNNCGMLHYTSGGQF              QLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS+NPVILFEHVLLYNLKE IPDEEY+ +LEEAEMVRPGEH+TILTYS+MRYHVMQ
Sbjct:  101 DRDPHVCVMGEDVGHYGGSYKVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSENPVILFEHVLLYNLKESIPDEEYICNLEEAEMVRPGEHITILTYSRMRYHVMQ 300          
BLAST of FE671359 vs. TAIR peptide
Match: AT5G50850.1 (| Symbols: MAB1 | Transketolase family protein | chr5:20689671-20692976 FORWARD LENGTH=363)

HSP 1 Score: 156.762 bits (395), Expect = 8.615e-39
Identity = 81/196 (41.33%), Postives = 120/196 (61.22%), Query Frame = 3
Query:   18 DASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLYN----LKERIPDEEYVLSLEEAEMVRPGEHVTILTYSKM 593
            D  V VMGE+VG Y G+YK+T+ L EK+G  RV DTPI E  FTG+G+GAA  GL+P+VE M   F + A + I N+    +Y S GQ                +GA+HSQ   +++ S+PG++++A  +  +A+GL+KAAIR  +PV+  E+ LLY     + E   D  + L + +A++ R G+ VTI+T+SKM
Sbjct:   53 DPKVFVMGEEVGQYQGAYKITKGLLEKYGPERVYDTPITEAGFTGIGVGAAYAGLKPVVEFMTFNFSMQAIDHIINSAAKSNYMSAGQINVPIVFRGPNGAAAGVGAQHSQCYAAWYASVPGLKVLAPYSAEDARGLLKAAIRDPDPVVFLENELLYGESFPISEEALDSSFCLPIGKAKIEREGKDVTIVTFSKM 248          
BLAST of FE671359 vs. TAIR peptide
Match: AT1G55510.1 (| Symbols: BCDH BETA1 | branched-chain alpha-keto acid decarboxylase E1 beta subunit | chr1:20723482-20725505 FORWARD LENGTH=352)

HSP 1 Score: 129.413 bits (324), Expect = 1.473e-30
Identity = 74/191 (38.74%), Postives = 103/191 (53.93%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAE-HSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLY-NLKERIPDEEYVLSLEEAEMVRPGEHVTIL 578
            + D    V GEDVG +GG ++ T  LAE+FG  RV +TP+ E    G GIG A  G R IVE     ++  AF+QI N      Y SG QF                G   HSQ  E++F  +PGI++V   +P  AKGL+ + IR  NPV+ FE   LY    E +P+ +Y++ L EAE++R G  +T++
Sbjct:   47 DTDPRSYVFGEDVG-FGGVFRCTTGLAERFGKNRVFNTPLCEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLYRQAVEEVPEHDYMIPLSEAEVIREGNDITLV 236          
BLAST of FE671359 vs. TAIR peptide
Match: AT3G13450.1 (| Symbols: DIN4 | Transketolase family protein | chr3:4382340-4384295 REVERSE LENGTH=358)

HSP 1 Score: 129.028 bits (323), Expect = 1.924e-30
Identity = 74/191 (38.74%), Postives = 104/191 (54.45%), Query Frame = 3
Query:   12 ERDASVCVMGEDVGHYGGSYKVTRNLAEKFGDLRVLDTPIAENAFTGMGIGAAMTGLRPIVEGMNMGFLLLAFNQISNNCGMLHYTSGGQFKXXXXXXXXXXXXXQLGAE-HSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRSDNPVILFEHVLLY-NLKERIPDEEYVLSLEEAEMVRPGEHVTIL 578
            E D    V GEDVG +GG ++ T  LAE+FG  RV +TP+ E    G GIG A  G R I E     ++  AF+QI N      Y SG QF                G   HSQ  E++F  +PGI++V   +P  AKGL+ ++IR  NPV+ FE   LY    E +P+++Y++ L EAE++R G  +T++
Sbjct:   53 ETDPRSYVFGEDVG-FGGVFRCTTGLAERFGKSRVFNTPLCEQGIVGFGIGLAAMGNRVIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEPKWLYRQAVEDVPEDDYMIPLSEAEVMREGSDITLV 242          
The following BLAST results are available for this feature:
BLAST of FE671359 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
ODPB_CHAGL1.163e-8475.00Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_ZYGCR1.983e-8474.50Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAPU4.419e-8474.50Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_CHAVU1.679e-8373.00Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_PORPU1.738e-8070.50Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_PORYE8.624e-8071.36Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_GRATL1.921e-7971.00Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_CYAME3.067e-7768.84Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_CYACA3.174e-7468.69Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_MESVI1.334e-7265.83Pyruvate dehydrogenase E1 component subunit beta O... [more]
back to top
BLAST of FE671359 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6TMA9_SOYBN6.966e-9889.00Putative uncharacterized protein OS=Glycine max PE... [more]
C6TDD9_SOYBN1.552e-9789.00Putative uncharacterized protein OS=Glycine max PE... [more]
B5LAW3_CAPAN1.314e-9687.50Putative pyruvate dehydrogenase E1 beta subunit OS... [more]
B9S0Z5_RICCO2.241e-9686.50Pyruvate dehydrogenase, putative OS=Ricinus commun... [more]
A9P9K0_POPTR3.823e-9686.50Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9IJS2_POPTR8.516e-9686.00Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q9C6Z3_ARATH3.236e-9585.00At1g30120/T2H7_8 OS=Arabidopsis thaliana GN=At1g30... [more]
O64688_ARATH4.226e-9585.00At2g34590 OS=Arabidopsis thaliana GN=At2g34590 PE=... [more]
O24458_ARATH4.226e-9584.50Pyruvate dehydrogenase E1 beta subunit OS=Arabidop... [more]
D7LH23_ARALY4.226e-9585.00Transketolase family protein OS=Arabidopsis lyrata... [more]
back to top
BLAST of FE671359 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 5
Match NameE-valueIdentityDescription
AT1G30120.12.383e-9785.00| Symbols: PDH-E1 BETA | pyruvate dehydrogenase E1... [more]
AT2G34590.13.112e-9785.00| Symbols: | Transketolase family protein | chr2:... [more]
AT5G50850.18.615e-3941.33| Symbols: MAB1 | Transketolase family protein | c... [more]
AT1G55510.11.473e-3038.74| Symbols: BCDH BETA1 | branched-chain alpha-keto ... [more]
AT3G13450.11.924e-3038.74| Symbols: DIN4 | Transketolase family protein | c... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 6..17
score
NoneNo IPR availableGENE3D3.40.50.970no descriptioncoord: 4..180
score: 1.1
NoneNo IPR availablePANTHERPTHR11624DEHYDROGENASE RELATEDcoord: 22..203
score: 6.5e
NoneNo IPR availablePANTHERPTHR11624:SF11PYRUVATE DEHYDROGENASE E1 COMPONENT, BETA SUBUNITcoord: 22..203
score: 6.5e
NoneNo IPR availableSEGsegsegcoord: 96..108
score
NoneNo IPR availableSUPERFAMILY52518Thiamin diphosphate-binding fold (THDP-binding)coord: 4..188
score: 6.7
NoneNo IPR availableSEGsegsegcoord: 47..63
score
NoneNo IPR availableSEGsegsegcoord: 29..39
score
IPR005475Transketolase-like, pyrimidine-binding domainPFAMPF02779Transket_pyrcoord: 4..163
score: 3.9
IPR005475Transketolase-like, pyrimidine-binding domainSMARTSM00861no descriptioncoord: 3..164
score: 1.8

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>FE671359 ID=FE671359|Name=FE671359|organism=Cicer arietinum|type=EST|length=611bp
ATTCGAATTCGGAAAGGGATGCTTCTGTTTGTGTCATGGGTGAAGATGTA
GGTCATTATGGGGGATCTTACAAGGTGACAAGAAACCTGGCTGAAAAGTT
TGGTGACCTCAGAGTTTTGGATACCCCTATTGCTGAGAATGCCTTCACTG
GCATGGGCATTGGAGCTGCCATGACTGGTCTGAGGCCAATTGTTGAGGGC
ATGAACATGGGATTTCTACTTCTGGCATTTAACCAAATCTCTAACAATTG
CGGCATGCTGCATTACACATCTGGTGGTCAGTTTAAAATACCAATCGTCA
TTCGTGGGCCTGGTGGAGTTGGGCGACAACTTGGAGCAGAACACTCACAG
AGGCTGGAGTCATATTTTCAATCAATCCCTGGTATTCAAATGGTGGCTTG
CTCAACACCTTACAATGCCAAGGGCTTGATGAAAGCTGCAATTCGAAGCG
ATAATCCTGTGATACTTTTCGAGCATGTTTTGCTTTATAACCTCAAGGAA
AGAATTCCAGACGAAGAGTATGTATTGTCACTCGAAGAAGCTGAGATGGT
CAGGCCCGGGGAGCATGTCACAATATTAACTTATTCGAAGATGAGGTATC
ATGTCATGCAA
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR005475Transketolase-like_Pyr-bd