FE671571

EST Overview
NameFE671571
Unique NameFE671571
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length620
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs Swissprot2010-12-28
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
InterProScan analysis for Cicer arietinum unigene v12010-12-29
Libraries
Library NameType
LIBEST_022820 Drought-stressed chickpea leave librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of FE671571 vs. SwissProt
Match: ACCA_PEA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic OS=Pisum sativum GN=ACCA PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.466e-21
Identity = 58/102 (56.86%), Postives = 70/102 (68.63%), Query Frame = 2
Query:    5 EIDILANSSTSIKSMIEQLKLEVARAGGKPDSESKNRIETLTQQIKQXXXXXXXXXXXXXXXKEKPENLVSGDGSLKKEGPTGDSLTDDELREKVGANRNFS 310
            EI+I+ANSS ++K +IEQLKLEVA++GGKPDSESK+RI+ LTQQIK+               KEK ENL           P GD+LTDD+LREKVG NRNFS
Sbjct:  787 EIEIVANSSPNVKRLIEQLKLEVAKSGGKPDSESKSRIDALTQQIKK----SLAEAVDSPSLKEKYENLTR---------PAGDTLTDDKLREKVGVNRNFS 875          
BLAST of FE671571 vs. TrEMBL
Match: Q9LLR0_SOYBN (Carboxyl transferase alpha subunit OS=Glycine max GN=accA-1 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.965e-11
Identity = 46/90 (51.11%), Postives = 51/90 (56.67%), Query Frame = 2
Query:    5 EIDILANSSTSIKSMIEQLKLEVARAGGKPDSESKNRIETLTQQIKQXXXXXXXXXXXXXXXKEKPENLVSGDGSLKKEGPTGDSLTDDE 274
            +I+ L NSS  IKS I QLKLEV +AG  PDSE KNRI  L Q IK                K+  ENLVS DGSL    P  DSLTDD+
Sbjct:  624 QIESLVNSSDDIKSKILQLKLEVPKAGETPDSEPKNRIGALVQLIK----PSLVEAVDSSGLKDLFENLVSNDGSLTHGDPARDSLTDDQ 709          
BLAST of FE671571 vs. TrEMBL
Match: Q42779_SOYBN (Alpha-carboxyltransferase aCT-1 OS=Glycine max GN=accA-1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.965e-11
Identity = 46/90 (51.11%), Postives = 51/90 (56.67%), Query Frame = 2
Query:    5 EIDILANSSTSIKSMIEQLKLEVARAGGKPDSESKNRIETLTQQIKQXXXXXXXXXXXXXXXKEKPENLVSGDGSLKKEGPTGDSLTDDE 274
            +I+ L NSS  IKS I QLKLEV +AG  PDSE KNRI  L Q IK                K+  ENLVS DGSL    P  DSLTDD+
Sbjct:  624 QIESLVNSSDDIKSKILQLKLEVPKAGETPDSEPKNRIGALVQLIK----PSLVEAVDSSGLKDLFENLVSNDGSLTHGDPARDSLTDDQ 709          
BLAST of FE671571 vs. TrEMBL
Match: B9SPE5_RICCO (Carboxyl-tansferase, subunit of Het-ACCase OS=Ricinus communis GN=RCOM_0085190 PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.069e-8
Identity = 44/105 (41.90%), Postives = 56/105 (53.33%), Query Frame = 2
Query:    5 EIDILANSSTSIKSMIEQLKLEVARAGGKPDSESKNRIETLTQQIKQXXXXXXXXXXXXXXXKEKPENLVSG-DGSLKKEGPTGDSLTDDELREKV--GANRNFS 310
            +I+ L NSS  IK+MI  LKLEVA+AG KPD  +KN+I  L QQIKQ               +E    +    DGSLK   P       DE R ++  GANR+F+
Sbjct:  663 KIEDLINSS-DIKNMINLLKLEVAKAGSKPDVTTKNKIVALEQQIKQKLSAAINSTELKQKFEELDLEVSEAIDGSLKNNDPMDRGAKHDESRVEINFGANRSFA 766          
BLAST of FE671571 vs. TrEMBL
Match: C9EI97_9ROSI (Alpha-biotin transcarboxylase subunit OS=Jatropha curcas PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.989e-7
Identity = 48/115 (41.74%), Postives = 57/115 (49.57%), Query Frame = 2
Query:    5 EIDILANSSTSIKSMIEQLKLEVARAGGKPDSESKNRIETLTQQIKQXXXXXXXXXXXXXXXKEKPENL-----------VSGDGSLKKEGPTGDSLTDDELREKV--GANRNFS 310
            +I+ L NSS   K+MIE LKLEVA+AG KPD  SKN+IE L  QIKQ               KEK E L              DGSLK +         DE R ++  GANR F+
Sbjct:  661 KIEGLINSS-DFKNMIELLKLEVAKAGNKPDVTSKNKIEALEHQIKQ----RLSSAINSTELKEKHEELKVEIFEAAEFAAGLDGSLKNDDSREGVSKHDESRVEINLGANRTFA 770          
The following BLAST results are available for this feature:
BLAST of FE671571 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 1
Match NameE-valueIdentityDescription
ACCA_PEA2.466e-2156.86Acetyl-coenzyme A carboxylase carboxyl transferase... [more]
back to top
BLAST of FE671571 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 4
Match NameE-valueIdentityDescription
Q9LLR0_SOYBN2.965e-1151.11Carboxyl transferase alpha subunit OS=Glycine max ... [more]
Q42779_SOYBN2.965e-1151.11Alpha-carboxyltransferase aCT-1 OS=Glycine max GN=... [more]
B9SPE5_RICCO3.069e-841.90Carboxyl-tansferase, subunit of Het-ACCase OS=Rici... [more]
C9EI97_9ROSI1.989e-741.74Alpha-biotin transcarboxylase subunit OS=Jatropha ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001095Acetyl-CoA carboxylase, alpha subunitPANTHERPTHR22855:SF3ACETYL-COENZYME A CARBOXYLASE CARBOXYL TRANSFERASE ALPHAcoord: 2..65
score: 1.3
NoneNo IPR availablePANTHERPTHR22855ACETYL, PROPIONYL, PYRUVATE, AND GLUTACONYL CARBOXYLASE-RELATEDcoord: 2..65
score: 1.3
NoneNo IPR availableSEGsegsegcoord: 49..63
score

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>FE671571 ID=FE671571|Name=FE671571|organism=Cicer arietinum|type=EST|length=620bp
ATTCGAAATTGATATTTTGGCAAACTCGTCGACAAGTATTAAGAGCATGA
TAGAGCAATTGAAACTGGAGGTTGCCAGGGCTGGAGGGAAACCAGATTCT
GAATCTAAGAACAGAATTGAGACTTTGACGCAACAGATTAAGCAGAGCCT
TGCCGAGGCCGTAGCCGAGGCCGTTGCCTCGTCTAGCTTGAAAGAGAAGC
CTGAAAATCTGGTGTCTGGAGACGGAAGTTTAAAAAAGGAAGGTCCAACA
GGAGACAGTCTCACCGATGACGAGTTGAGAGAGAAAGTTGGTGCAAATCG
CAACTTTTCTTAATAGACTGCTTCTCAAGTTGAGTTGGTGAAGATGGTGT
TGACAGTGGAAACTGCATCAGTAAGATATATTTTACCAATATTTTCAGCT
AGTTGTACATCTAGCTTCATGATCATATTTCTTAGAAACATGTTTTGAAG
ATTTAAAGAAGATACGATGCGAATTGTGGCTGATATTTTTCAATCATCTT
GACTACAAGCGCGAATAAAACTCAAAACCATTTTGTATTTGTTTGAGTTA
GAATGTTGCAGTTGATTTTAGAATGACTTGCTTTATCTACATCTTTTTTG
TTCTTTTTTATAATTTAAAA
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0003989acetyl-CoA carboxylase activity
Vocabulary: Biological Process
TermDefinition
GO:0006633fatty acid biosynthetic process
Vocabulary: Cellular Component
TermDefinition
GO:0009317acetyl-CoA carboxylase complex
Vocabulary: INTERPRO
TermDefinition
IPR001095Acetyl_CoA_COase_a_su