FE672044

EST Overview
NameFE672044
Unique NameFE672044
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length669
Libraries
Library NameType
LIBEST_022820 Drought-stressed chickpea leave librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of FE672044 vs. SwissProt
Match: STS1_ARATH (Strictosidine synthase 1 OS=Arabidopsis thaliana GN=SS1 PE=2 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 3.518e-32
Identity = 68/148 (45.95%), Postives = 93/148 (62.84%), Query Frame = 1
Query:  169 GPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTT--SNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPI 606
            GPE+ AFD  G+G YTGV+ G+ILK+   E G+  FA  T  SN S C   I   L   CGRP G+ F++K GDLY+ADA  GL+V+ P GGLAT++    +G+PF+F + +D+     V+YFT FS+ F   Q ++AL   D TG +
Sbjct:   38 GPEAFAFDSTGKGFYTGVSGGKILKYL-PETGYVDFAQITESSNSSWCDGTIGTALAGRCGRPAGIAFNEKTGDLYVADAPLGLHVISPAGGLATKITDSVDGKPFKFLDGLDVDPTTGVVYFTSFSSRFSPIQVLIALGLKDATGKL 184          

HSP 2 Score: 29.261 bits (64), Expect = 3.518e-32
Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  599 GRLMKYDKSTKEVKVLLRGLA 661
            G+L KYD STK V VL+ GL+
Sbjct:  182 GKLYKYDPSTKVVTVLMEGLS 202          
BLAST of FE672044 vs. SwissProt
Match: STSY_RAUSE (Strictosidine synthase OS=Rauvolfia serpentina GN=STR1 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.880e-27
Identity = 56/154 (36.36%), Postives = 86/154 (55.84%), Query Frame = 1
Query:  145 ILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTS--NRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            IL  + +  P S  FD   +G YT V DGR++K+EG   G+  FA  +   N++ C      E   +CGR   + ++ +N  LYI D Y+ L+VVG EGG ATQ+ T  +G PF++   + + +   ++YFTD ST++  R     + + DKTG
Sbjct:   34 ILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASPYWNKAFCENSTDAEKRPLCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLATSVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTG 187          

HSP 2 Score: 29.6462 bits (65), Expect = 3.880e-27
Identity = 13/22 (59.09%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGL 658
            + GRL+KYD STKE  +LL+ L
Sbjct:  185 KTGRLIKYDPSTKETTLLLKEL 206          
BLAST of FE672044 vs. SwissProt
Match: STSY_RAUMA (Strictosidine synthase (Fragment) OS=Rauvolfia mannii GN=STR1 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.880e-27
Identity = 56/154 (36.36%), Postives = 86/154 (55.84%), Query Frame = 1
Query:  145 ILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTS--NRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            IL  + +  P S  FD   +G YT V DGR++K+EG   G+  FA  +   N++ C      E   +CGR   + ++ +N  LYI D Y+ L+VVG EGG ATQ+ T  +G PF++   + + +   ++YFTD ST++  R     + + DKTG
Sbjct:   32 ILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASPYWNKAFCENSTDAEKRPLCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLATSVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTG 185          

HSP 2 Score: 29.6462 bits (65), Expect = 3.880e-27
Identity = 13/22 (59.09%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGL 658
            + GRL+KYD STKE  +LL+ L
Sbjct:  183 KTGRLIKYDPSTKETTLLLKEL 204          
BLAST of FE672044 vs. SwissProt
Match: STS3_ARATH (Strictosidine synthase 3 OS=Arabidopsis thaliana GN=SS3 PE=2 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 8.631e-26
Identity = 61/146 (41.78%), Postives = 88/146 (60.27%), Query Frame = 1
Query:  169 GPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHV--CGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            GPE+ AFD  G+G YTGV  G+ILK+   ++G+  FA  T++    +   AL   +V  CGRP G+ F+ K GDLY+ADA  GL+V+   GGLA ++     G+PF F + +D+     V+YFT FS+ F  R  + A+ + D TG
Sbjct:   40 GPEAFAFDSTGKGFYTGVTGGKILKYL-PKKGYVDFAQITNSSKSSLCDGALGTTNVEKCGRPAGIAFNTKTGDLYVADAALGLHVIPRRGGLAKKIADSVGGKPFLFLDGLDVDPTTGVVYFTSFSSTFGPRDVLKAVATKDSTG 184          
BLAST of FE672044 vs. SwissProt
Match: STSY_CATRO (Strictosidine synthase OS=Catharanthus roseus GN=STR1 PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 2.631e-25
Identity = 50/138 (36.23%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  142 RILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTS--NRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTV 549
            +I   S +  P +  FD   +G YT V DGR++K+EG   G+T FA  +   N++ C      E   +CGR   + +D KN  +YI D ++ L VVG EGG ATQ+ T  +G PF++   + + +   ++YFTD S++
Sbjct:   37 KIFIESPSYAPNAFTFDSTDKGFYTSVQDGRVIKYEGPNSGFTDFAYASPFWNKAFCENSTDPEKRPLCGRTYDISYDYKNSQMYIVDGHYHLCVVGKEGGYATQLATSVQGVPFKWLYAVTVDQRTGIVYFTDVSSI 174          

HSP 2 Score: 32.3426 bits (72), Expect = 2.631e-25
Identity = 15/22 (68.18%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGL 658
            R GRLMKYD STKE  +LL+ L
Sbjct:  191 RTGRLMKYDPSTKETTLLLKEL 212          
BLAST of FE672044 vs. SwissProt
Match: APMAP_DANRE (Adipocyte plasma membrane-associated protein OS=Danio rerio GN=apmap PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.689e-19
Identity = 64/164 (39.02%), Postives = 86/164 (52.44%), Query Frame = 1
Query:  130 LHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAE---GQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPINE 612
            L  A  L     VGPESLA    G   YTG ADG+I+K EG         L T  +  C    + E EH CGRPLG++    NG L++ADAY GL  V P  G    +V+  +   G+   F ND+D+++D   +YFTD S+ +QRR FM  ++     G + E
Sbjct:   87 LRQAERLFEERLVGPESLA--NIGDVFYTGTADGKIVKIEGRNI----HVLATIGKPPCG---SREHEHTCGRPLGIRVGP-NGTLFVADAYLGLFEVNPVTGEVKSLVSTEKRIAGRRLGFVNDLDVTQDGKKVYFTDSSSRWQRRDFMHLIMEATADGRVLE 240          
BLAST of FE672044 vs. SwissProt
Match: APMAP_HUMAN (Adipocyte plasma membrane-associated protein OS=Homo sapiens GN=APMAP PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.130e-17
Identity = 67/183 (36.61%), Postives = 93/183 (50.82%), Query Frame = 1
Query:   76 FNPQNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWE-GEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGP---EGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPINE 612
            F    L + +  P +K  L  A  L  +  VGPES+A  G+    +TG ADGR++K E GE     +F        D         E VCGRPLG++    NG L++ADAY GL  V P   E  L     T  EG+   F ND+ +++D   IYFTD S+ +QRR ++L ++ G   G + E
Sbjct:   72 FKEPPLLLGVLHPNTK--LRQAERLFENQLVGPESIAHIGDVM--FTGTADGRVVKLENGEIETIARFGSGPCKTRDD--------EPVCGRPLGIRAGP-NGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLE 241          
BLAST of FE672044 vs. SwissProt
Match: APMAP_SALSA (Adipocyte plasma membrane-associated protein OS=Salmo salar GN=apmap PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.476e-17
Identity = 62/164 (37.80%), Postives = 87/164 (53.05%), Query Frame = 1
Query:  130 LHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAE---GQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPINE 612
            L  A+ L     VGPES+A    G   YTG ADG+I+K EG  +  T  A       D  R    E E  CGRPLG++    NG L++ADAY GL  V P  G  T +V+  +   G+   F ND+D+++D   +YFTD S+ +QRR ++  ++     G + E
Sbjct:   87 LREAQRLFEDQLVGPESIA--NFGDLIYTGTADGKIVKIEG--KSITVIARLGKPPCDGSR----EQEPSCGRPLGIRVGP-NGTLFVADAYLGLFKVNPVTGEVTNLVSAGQMVGGRRLSFVNDLDVTQDGRKVYFTDSSSRWQRRDYLHLIMEATADGRVLE 241          
BLAST of FE672044 vs. SwissProt
Match: APMAP_CHICK (Adipocyte plasma membrane-associated protein OS=Gallus gallus GN=APMAP PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.927e-17
Identity = 68/189 (35.98%), Postives = 93/189 (49.21%), Query Frame = 1
Query:   91 LFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVV---TEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPINEI**VNKRSEGLI 648
            L   +  P +K  L  A  L  +  VGPES+     G   +TG ADG+ILK E  E       +       C  P   E E  CGRPLG++    N  L++ADAY+GL  V P  G    +V   T  EGQ   F ND+ +++D   IYFTD S+ +QRR F+  ++ G   G + E   V K  + L+
Sbjct:   76 LLTGVLEPNNK--LQKAERLWENQLVGPESIV--NIGDVLFTGTADGKILKIEDGEVQ----TVARIGHGPCGTP---EDEPTCGRPLGIRVGPNN-TLFVADAYYGLYEVNPGTGETKMLVSTKTLIEGQKLSFLNDLTVTQDGRKIYFTDSSSKWQRRDFLFLVMEGTDDGRLLEYDTVTKEVKVLM 252          
BLAST of FE672044 vs. SwissProt
Match: APMAP_BOVIN (Adipocyte plasma membrane-associated protein OS=Bos taurus GN=APMAP PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.927e-17
Identity = 67/183 (36.61%), Postives = 91/183 (49.73%), Query Frame = 1
Query:   76 FNPQNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWE-GEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGP---EGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPINE 612
            F    LF+ +  P +K  L  A  L  +  VGPES+A  G+    +TG ADGR++K E GE     +F        D         E  CGRPLG++    NG L++ DAY GL  V P   E  L     T  EG+   F ND+ ++ D   IYFTD S+ +QRR ++L L+ G   G + E
Sbjct:   71 FKEPPLFLGVLQPNTK--LQQAERLFENQLVGPESIANIGDVM--FTGTADGRVVKLENGEVETIARFGSGPCKTRDD--------EPACGRPLGIRAGP-NGTLFVVDAYKGLFEVNPWKREVKLLLSSETPIEGRKMSFLNDLTVTRDGRKIYFTDSSSKWQRRDYLLLLMEGTDDGRLLE 240          
BLAST of FE672044 vs. TrEMBL
Match: B9T2X5_RICCO (Strictosidine synthase, putative OS=Ricinus communis GN=RCOM_0158670 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.877e-76
Identity = 124/174 (71.26%), Postives = 142/174 (81.61%), Query Frame = 1
Query:   79 NPQNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            NP N+F P  +P S D+LH+A+I+ ++GAVGPESL FD NG+GPYTGVADGRILKW+G+  GWT FA TTSNR +C+RP A ELEHVCGRPLGL+FDKK GDLYIADAY GL VVGP GGLAT VV+E EG P RFTNDMDI E  DVIYFTD S +FQRRQFM ++L  DKTG
Sbjct:   24 NPNNIFAPPPLPSSNDNLHSAKIVPITGAVGPESLVFDPNGEGPYTGVADGRILKWQGDSLGWTDFAFTTSNRKECIRPFAPELEHVCGRPLGLRFDKKTGDLYIADAYLGLQVVGPNGGLATPVVSEVEGHPLRFTNDMDIDEQNDVIYFTDTSKIFQRRQFMASILHKDKTG 197          

HSP 2 Score: 40.0466 bits (92), Expect = 3.877e-76
Identity = 18/29 (62.07%), Postives = 24/29 (82.76%), Query Frame = 2
Query:  581 LVETRPGRLMKYDKSTKEVKVLLRGLAFA 667
            L + + GRL+KYDKS+KEV +LL GL+FA
Sbjct:  191 LHKDKTGRLLKYDKSSKEVTILLEGLSFA 219          
BLAST of FE672044 vs. TrEMBL
Match: D7TIN1_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_7.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00033611001 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 7.887e-74
Identity = 122/174 (70.11%), Postives = 140/174 (80.46%), Query Frame = 1
Query:   79 NPQNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            N  +LF P +IPG+ D LH + ++ V+GA GPES+AFD  G+GPYTGVADGR+LKWEG+ RGWT FA+TTS R +CVRP A E+EH+CGRPLGL+FDKK GDLYIADAYFGL VV P GGLAT +VTE EG+   FTNDMDI E EDVIYFTD ST F RRQFM ALLSGD TG
Sbjct:   22 NSNHLFKPPSIPGTHDLLHGSEVIQVTGAFGPESIAFDPKGEGPYTGVADGRVLKWEGDGRGWTDFAVTTSERKECVRPFAPEMEHICGRPLGLRFDKKTGDLYIADAYFGLQVVEPNGGLATPLVTEVEGRRLLFTNDMDIDEVEDVIYFTDTSTDFHRRQFMAALLSGDNTG 195          

HSP 2 Score: 43.8986 bits (102), Expect = 7.887e-74
Identity = 21/23 (91.30%), Postives = 22/23 (95.65%), Query Frame = 2
Query:  599 GRLMKYDKSTKEVKVLLRGLAFA 667
            GRLMKYDKS+KEV VLLRGLAFA
Sbjct:  195 GRLMKYDKSSKEVTVLLRGLAFA 217          
BLAST of FE672044 vs. TrEMBL
Match: B9IHS3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_835391 PE=4 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.430e-68
Identity = 129/179 (72.07%), Postives = 145/179 (81.01%), Query Frame = 1
Query:   73 LFNPQNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERG---WTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            L +P  L  P TIP S D LH+A+ILHVSGAVGPESL FD NG+GPYTGVADGR+LKW   + G   WT FA T+SNR++CVRP A E+EHVCGRPLGL+FDKK G+LYIADAY GL VVGP GGLAT VVTE EGQP RFTND+DI E EDVIYFTD S VFQRRQF+L+LL+ DKTG
Sbjct:   22 LTSPTKLLGPPTIPTSNDHLHSAKILHVSGAVGPESLVFDPNGEGPYTGVADGRVLKWIAGDDGSGSWTDFATTSSNRNECVRPFAPEMEHVCGRPLGLRFDKKTGNLYIADAYLGLQVVGPTGGLATPVVTELEGQPMRFTNDLDIDEQEDVIYFTDTSMVFQRRQFILSLLTKDKTG 200          
BLAST of FE672044 vs. TrEMBL
Match: Q4V3D9_ARATH (At3g57030 OS=Arabidopsis thaliana GN=At3g57030 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 7.811e-68
Identity = 117/170 (68.82%), Postives = 138/170 (81.18%), Query Frame = 1
Query:   91 LFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            +F P  I GS+D   +A++++++GA GPES+AFD  G+GPY GV+DGRILKW GE  GW+ FA T+SNR +C RP A ELEHVCGRPLGL+FDKK GDLYIADAYFGL VVGP GGLA  +VTEAEGQPFRFTND+DI E EDVIYFTD S  FQRRQF+ A+L+ DKTG
Sbjct:   30 IFAPPEISGSRDVFPSAKVVNLTGASGPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNRQECARPFAPELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTG 199          

HSP 2 Score: 35.4242 bits (80), Expect = 7.811e-68
Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGLAFA 667
            + GR +KYD+S+K+  VLL+GLAFA
Sbjct:  197 KTGRFIKYDRSSKKATVLLQGLAFA 221          
BLAST of FE672044 vs. TrEMBL
Match: Q0WST9_ARATH (Putative uncharacterized protein At3g57030 OS=Arabidopsis thaliana GN=At3g57030 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 7.811e-68
Identity = 117/170 (68.82%), Postives = 138/170 (81.18%), Query Frame = 1
Query:   91 LFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            +F P  I GS+D   +A++++++GA GPES+AFD  G+GPY GV+DGRILKW GE  GW+ FA T+SNR +C RP A ELEHVCGRPLGL+FDKK GDLYIADAYFGL VVGP GGLA  +VTEAEGQPFRFTND+DI E EDVIYFTD S  FQRRQF+ A+L+ DKTG
Sbjct:   30 IFAPPEISGSRDVFPSAKVVNLTGASGPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNRQECARPFAPELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTG 199          

HSP 2 Score: 35.4242 bits (80), Expect = 7.811e-68
Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGLAFA 667
            + GR +KYD+S+K+  VLL+GLAFA
Sbjct:  197 KTGRFIKYDRSSKKATVLLQGLAFA 221          
BLAST of FE672044 vs. TrEMBL
Match: Q9M1J5_ARATH (Putative uncharacterized protein F24I3.110 OS=Arabidopsis thaliana GN=F24I3.110 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 7.812e-68
Identity = 117/170 (68.82%), Postives = 138/170 (81.18%), Query Frame = 1
Query:   91 LFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            +F P  I GS+D   +A++++++GA GPES+AFD  G+GPY GV+DGRILKW GE  GW+ FA T+SNR +C RP A ELEHVCGRPLGL+FDKK GDLYIADAYFGL VVGP GGLA  +VTEAEGQPFRFTND+DI E EDVIYFTD S  FQRRQF+ A+L+ DKTG
Sbjct:   28 IFAPPEISGSRDVFPSAKVVNLTGASGPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNRQECARPFAPELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTG 197          

HSP 2 Score: 35.4242 bits (80), Expect = 7.812e-68
Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGLAFA 667
            + GR +KYD+S+K+  VLL+GLAFA
Sbjct:  195 KTGRFIKYDRSSKKATVLLQGLAFA 219          
BLAST of FE672044 vs. TrEMBL
Match: D7LVM7_ARALY (Strictosidine synthase family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_907158 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.732e-67
Identity = 116/170 (68.24%), Postives = 137/170 (80.59%), Query Frame = 1
Query:   91 LFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            +F P  I GS+D   +A+++ ++GA GPES+AFD  G+GPY GV+DGR+LKW  E  GW+ FA T+SNR +CVRP A ELEHVCGRPLGL+FDKK GDLYIADAYFGL VVGP GGLA  +VTEAEGQPFRFTND+DI E EDVIYFTD S  FQRRQF+ A+L+ DKTG
Sbjct:   30 IFAPPEISGSRDVFPSAKVVTLTGASGPESIAFDPAGEGPYVGVSDGRVLKWRSESLGWSDFAYTSSNRQECVRPFAPELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTG 199          

HSP 2 Score: 35.4242 bits (80), Expect = 1.732e-67
Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGLAFA 667
            + GR +KYD+S+K+  VLL+GLAFA
Sbjct:  197 KTGRFIKYDRSSKKATVLLQGLAFA 221          
BLAST of FE672044 vs. TrEMBL
Match: A7WPL3_TOBAC (Strictosidine synthase-like protein OS=Nicotiana tabacum GN=T221 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.009e-67
Identity = 111/172 (64.53%), Postives = 136/172 (79.07%), Query Frame = 1
Query:   85 QNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            +N+F P  IPGS+D L  A ++ + GA G ES+AFD NG+GPYTGVADGRILKW+   + W  FA+T+S R +C RP A E+EHVCGRPLGL+FD K GDLYIADAYFGL+VVGP GGLAT +V + EGQP  FTND+DI +D+D+IYFTD ST++QRRQF+ A  SGDKTG
Sbjct:   33 ENVFKPAPIPGSQDVLSKAELIQLKGAFGAESVAFDPNGEGPYTGVADGRILKWQPHSQTWVDFAVTSSQRKNCSRPSAPEMEHVCGRPLGLRFDHKTGDLYIADAYFGLHVVGPTGGLATPLVQDFEGQPLLFTNDLDIDDDDDIIYFTDTSTIYQRRQFVAATASGDKTG 204          

HSP 2 Score: 39.2762 bits (90), Expect = 5.009e-67
Identity = 19/25 (76.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGLAFA 667
            + GRLMKY+KSTKEV V L GLAFA
Sbjct:  202 KTGRLMKYNKSTKEVTVALGGLAFA 226          
BLAST of FE672044 vs. TrEMBL
Match: Q9LKW1_SOLLC (Putative strictosidine synthase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 2.376e-54
Identity = 97/175 (55.43%), Postives = 130/175 (74.29%), Query Frame = 1
Query:   85 QNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWE---GEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            Q + V +    +++ L  ++I+H++G++GPES+AFD NG+GPY GVADGRILK +        W +FA+T+S+R DC  P A ++EH+CGRPLGL+FD K G+LYIADAY GL VVGP+GGLAT +V + EG+P  FTND+DI  D+DVIYFTD ST +QR QF+ +  SGD TG
Sbjct:   14 QLVSVNLAFEKTQNVLSKSKIIHLNGSIGPESVAFDPNGEGPYIGVADGRILKLQLGSNNRLFWAEFAVTSSHRRDCTSPFAPKMEHICGRPLGLRFDTKTGELYIADAYLGLQVVGPKGGLATPLVQKFEGKPLVFTNDVDI--DDDVIYFTDTSTKYQRWQFLTSFSSGDTTG 186          

HSP 2 Score: 38.5058 bits (88), Expect = 2.376e-54
Identity = 19/23 (82.61%), Postives = 20/23 (86.96%), Query Frame = 2
Query:  599 GRLMKYDKSTKEVKVLLRGLAFA 667
            GRLMKYDKSTK+V VLL  LAFA
Sbjct:  186 GRLMKYDKSTKKVTVLLGDLAFA 208          
BLAST of FE672044 vs. TrEMBL
Match: D7SSZ3_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_575.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00007473001 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 3.322e-50
Identity = 89/150 (59.33%), Postives = 111/150 (74.00%), Query Frame = 1
Query:  157 SGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNR--SDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            SG  GPES+AFD NG GPYTG++DGRILKW+G + GW +FA+T+  R  + C   + L +E VCGRPLGLKF++   DLYIADAYFGL VVG  GG+A QV   AEG PFRFTN +DI ++  V+YFTD ST+FQR  + +A+  GDKTG
Sbjct:   35 SGVFGPESIAFDCNGDGPYTGISDGRILKWQGSKHGWKEFAITSPFRIPNFCDGSLNLAIEQVCGRPLGLKFNEATCDLYIADAYFGLLVVGQNGGVAKQVAISAEGVPFRFTNALDIDQNTGVVYFTDTSTIFQRWAYAIAMQIGDKTG 184          

HSP 2 Score: 38.1206 bits (87), Expect = 3.322e-50
Identity = 17/25 (68.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGLAFA 667
            + GRL+KYD  TKEV VLLRGL+F+
Sbjct:  182 KTGRLLKYDPRTKEVTVLLRGLSFS 206          
BLAST of FE672044 vs. TAIR peptide
Match: AT3G57030.1 (| Symbols: | Calcium-dependent phosphotriesterase superfamily protein | chr3:21101653-21103204 REVERSE LENGTH=374)

HSP 1 Score: 247.284 bits (630), Expect = 5.392e-70
Identity = 117/170 (68.82%), Postives = 138/170 (81.18%), Query Frame = 1
Query:   91 LFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            +F P  I GS+D   +A++++++GA GPES+AFD  G+GPY GV+DGRILKW GE  GW+ FA T+SNR +C RP A ELEHVCGRPLGL+FDKK GDLYIADAYFGL VVGP GGLA  +VTEAEGQPFRFTND+DI E EDVIYFTD S  FQRRQF+ A+L+ DKTG
Sbjct:   30 IFAPPEISGSRDVFPSAKVVNLTGASGPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNRQECARPFAPELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDIDEQEDVIYFTDTSARFQRRQFLAAVLNVDKTG 199          

HSP 2 Score: 35.4242 bits (80), Expect = 5.392e-70
Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGLAFA 667
            + GR +KYD+S+K+  VLL+GLAFA
Sbjct:  197 KTGRFIKYDRSSKKATVLLQGLAFA 221          
BLAST of FE672044 vs. TAIR peptide
Match: AT1G08470.1 (| Symbols: SSL3 | strictosidine synthase-like 3 | chr1:2682262-2683977 REVERSE LENGTH=390)

HSP 1 Score: 186.037 bits (471), Expect = 2.925e-49
Identity = 95/164 (57.93%), Postives = 118/164 (71.95%), Query Frame = 1
Query:  130 LHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIA-----LELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPI 606
            L  + I  ++   GPES+AFD  G+GPYTGVADGRIL W G    WT FA T++NRS+   P       L+ E +CGRPLGL+FDKKNGDLYIADAY G+  VGPEGGLAT V  EA+G P RFTND+DI +DE  +YFTD S+ FQRR+FML ++SG+ +G +
Sbjct:   56 LQNSEIRFLNEVQGPESIAFDPQGRGPYTGVADGRILFWNGTR--WTDFAYTSNNRSELCDPKPSLLDYLKDEDICGRPLGLRFDKKNGDLYIADAYLGIMKVGPEGGLATSVTNEADGVPLRFTNDLDI-DDEGNVYFTDSSSFFQRRKFMLLIVSGEDSGRV 216          

HSP 2 Score: 27.335 bits (59), Expect = 2.925e-49
Identity = 11/22 (50.00%), Postives = 15/22 (68.18%), Query Frame = 2
Query:  599 GRLMKYDKSTKEVKVLLRGLAF 664
            GR++KY+  TKE   L+R L F
Sbjct:  214 GRVLKYNPKTKETTTLVRNLQF 235          
BLAST of FE672044 vs. TAIR peptide
Match: AT5G22020.1 (| Symbols: | Calcium-dependent phosphotriesterase superfamily protein | chr5:7287878-7289357 REVERSE LENGTH=395)

HSP 1 Score: 189.504 bits (480), Expect = 1.390e-48
Identity = 100/182 (54.95%), Postives = 129/182 (70.88%), Query Frame = 1
Query:  118 SKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCV--RPIALEL---EHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPINEI**VNKRSEGLI 648
            S++ L  ++IL  +   GPES+AFD  G+GPYTGVADGR+L W+GE+  W  FA T+SNRS+    +P AL     EH+CGRPLGL+FDK+ GDLYIADAY GL  VGPEGGLAT +VTEAEG P  FTND+DI+ D+  +YFTD S  +QRR F+  + SGD TG + +   V K++  L+
Sbjct:   58 SQNSLQKSKILFFNQIQGPESVAFDSLGRGPYTGVADGRVLFWDGEK--WIDFAYTSSNRSEICDPKPSALSYLRNEHICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGLATPLVTEAEGVPLGFTNDLDIA-DDGTVYFTDSSISYQRRNFLQLVFSGDNTGRVLKYDPVAKKAVVLV 236          
BLAST of FE672044 vs. TAIR peptide
Match: AT2G41290.1 (| Symbols: SSL2 | strictosidine synthase-like 2 | chr2:17210599-17212904 REVERSE LENGTH=376)

HSP 1 Score: 178.333 bits (451), Expect = 1.556e-47
Identity = 87/154 (56.49%), Postives = 108/154 (70.13%), Query Frame = 1
Query:  142 RILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALE-LEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            R++  +GA+GPES  FD  G GPYTG++DGRI+KW   E  W  FA+TTS R  C  P   +  EHVCGRPLGL FDK  GDLYIADAY GL  VGP GG+ATQV+     +  RFTN +DI+    V+YFTD S+V+QRR ++ A++SGDKTG
Sbjct:   42 RLIPTTGALGPESFVFDFFGDGPYTGLSDGRIVKWLANESRWIDFAVTTSAREGCEGPHEHQRTEHVCGRPLGLAFDKSTGDLYIADAYMGLLKVGPTGGVATQVLPRELNEALRFTNSLDINPRTGVVYFTDSSSVYQRRNYIGAMMSGDKTG 195          

HSP 2 Score: 29.261 bits (64), Expect = 1.556e-47
Identity = 15/24 (62.50%), Postives = 18/24 (75.00%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGLAF 664
            + GRLMKYD +TK+V  LL  LAF
Sbjct:  193 KTGRLMKYD-NTKQVTTLLSNLAF 215          
BLAST of FE672044 vs. TAIR peptide
Match: AT3G57020.1 (| Symbols: | Calcium-dependent phosphotriesterase superfamily protein | chr3:21098515-21100303 REVERSE LENGTH=370)

HSP 1 Score: 169.474 bits (428), Expect = 3.106e-45
Identity = 85/179 (47.49%), Postives = 112/179 (62.57%), Query Frame = 1
Query:   70 SLFNPQNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPI 606
            S+ + Q L VP  + G+K+ L  A+ + +  A GPES+ FD  G+GPY  V DGRILKW G++ GW  FA T+ +R +C +    E+   CGRPLGL F+KK GDLYI D Y GL  VGPEGGLA  +V EAEG+   F N  DI E+EDV YF D S  +  R      +SG+++G +
Sbjct:   21 SVISYQTLIVPENLEGAKNVLTMAKTIPIPVA-GPESIEFDPKGEGPYAAVVDGRILKWRGDDLGWVDFAYTSPHRGNCSKT---EVVPTCGRPLGLTFEKKTGDLYICDGYLGLMKVGPEGGLAELIVDEAEGRKVMFANQGDIDEEEDVFYFNDSSDKYHFRDVFFVAVSGERSGRV 195          

HSP 2 Score: 30.4166 bits (67), Expect = 3.106e-45
Identity = 12/22 (54.55%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGL 658
            R GR+++YDK TKE KV++  L
Sbjct:  191 RSGRVIRYDKKTKEAKVIMDNL 212          
BLAST of FE672044 vs. TAIR peptide
Match: AT3G57010.1 (| Symbols: | Calcium-dependent phosphotriesterase superfamily protein | chr3:21095854-21097316 REVERSE LENGTH=376)

HSP 1 Score: 165.236 bits (417), Expect = 1.783e-42
Identity = 85/169 (50.30%), Postives = 104/169 (61.54%), Query Frame = 1
Query:  100 PITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPI 606
            P  + G+K  L  A+ + +    GPESL FD  G+GPY GV DGRILKW GEE GW  FA T+ +R +C    + E+   CGRPLGL F++K GDLYI D YFG+  VGPEGGLA  VV EAEG+   F N  DI E+ED+ YF D S  +  R      LSG K G +
Sbjct:   32 PDNLKGTKHVLQDAKTIPLP-VDGPESLEFDPQGEGPYVGVTDGRILKWRGEELGWVDFAYTSPHRDNCS---SHEVVPSCGRPLGLSFERKTGDLYICDGYFGVMKVGPEGGLAELVVDEAEGRKVMFANQGDIDEEEDIFYFNDSSDTYHFRDVFYVSLSGTKVGRV 196          

HSP 2 Score: 25.409 bits (54), Expect = 1.783e-42
Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 2
Query:  590 TRPGRLMKYDKSTKEVKVLL 649
            T+ GR+++YD   KE KV++
Sbjct:  191 TKVGRVIRYDMKKKEAKVIM 210          
BLAST of FE672044 vs. TAIR peptide
Match: AT3G57020.2 (| Symbols: | Calcium-dependent phosphotriesterase superfamily protein | chr3:21098515-21100303 REVERSE LENGTH=356)

HSP 1 Score: 152.14 bits (383), Expect = 4.618e-40
Identity = 80/179 (44.69%), Postives = 104/179 (58.10%), Query Frame = 1
Query:   70 SLFNPQNLFVPITIPGSKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTGPI 606
            S+ + Q L VP  + G+K+ L  A+ + +  A GPES+ FD  G+GPY  V DGRILKW G++ GW  FA T+ +R                 PLGL F+KK GDLYI D Y GL  VGPEGGLA  +V EAEG+   F N  DI E+EDV YF D S  +  R      +SG+++G +
Sbjct:   21 SVISYQTLIVPENLEGAKNVLTMAKTIPIPVA-GPESIEFDPKGEGPYAAVVDGRILKWRGDDLGWVDFAYTSPHR-----------------PLGLTFEKKTGDLYICDGYLGLMKVGPEGGLAELIVDEAEGRKVMFANQGDIDEEEDVFYFNDSSDKYHFRDVFFVAVSGERSGRV 181          

HSP 2 Score: 30.4166 bits (67), Expect = 4.618e-40
Identity = 12/22 (54.55%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  593 RPGRLMKYDKSTKEVKVLLRGL 658
            R GR+++YDK TKE KV++  L
Sbjct:  177 RSGRVIRYDKKTKEAKVIMDNL 198          
BLAST of FE672044 vs. TAIR peptide
Match: AT3G59530.2 (| Symbols: LAP3 | Calcium-dependent phosphotriesterase superfamily protein | chr3:21993710-21995164 FORWARD LENGTH=403)

HSP 1 Score: 154.451 bits (389), Expect = 4.956e-38
Identity = 79/157 (50.32%), Postives = 102/157 (64.97%), Query Frame = 1
Query:  154 VSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSD--CVRPI------ALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            V    GPESL FD  G+GPYTG+ADGR+++W GE  GW  F++ TS  S+  CVR +        + E +CGRPLGL+F K+ G+LYIADAY+GL VVGPEGG+AT + T  EG+P  F ND+DI  +   I+FTD S  + R      LL G+ TG
Sbjct:   79 VDQVFGPESLEFDSLGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEEACVRGVDSTTNKQWKHEKLCGRPLGLRFHKETGNLYIADAYYGLLVVGPEGGIATPLATHVEGKPILFANDLDIHRNGS-IFFTDTSKRYDRANHFFILLEGESTG 234          
BLAST of FE672044 vs. TAIR peptide
Match: AT3G59530.1 (| Symbols: LAP3 | Calcium-dependent phosphotriesterase superfamily protein | chr3:21993710-21995164 FORWARD LENGTH=403)

HSP 1 Score: 154.451 bits (389), Expect = 4.956e-38
Identity = 79/157 (50.32%), Postives = 102/157 (64.97%), Query Frame = 1
Query:  154 VSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSD--CVRPI------ALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            V    GPESL FD  G+GPYTG+ADGR+++W GE  GW  F++ TS  S+  CVR +        + E +CGRPLGL+F K+ G+LYIADAY+GL VVGPEGG+AT + T  EG+P  F ND+DI  +   I+FTD S  + R      LL G+ TG
Sbjct:   79 VDQVFGPESLEFDSLGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEEACVRGVDSTTNKQWKHEKLCGRPLGLRFHKETGNLYIADAYYGLLVVGPEGGIATPLATHVEGKPILFANDLDIHRNGS-IFFTDTSKRYDRANHFFILLEGESTG 234          
BLAST of FE672044 vs. TAIR peptide
Match: AT2G41300.1 (| Symbols: SSL1 | strictosidine synthase-like 1 | chr2:17214312-17216292 REVERSE LENGTH=394)

HSP 1 Score: 152.14 bits (383), Expect = 2.460e-37
Identity = 72/137 (52.55%), Postives = 90/137 (65.69%), Query Frame = 1
Query:  190 DGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNRSDCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQVVTEAEGQPFRFTNDMDISEDEDVIYFTDFSTVFQRRQFMLALLSGDKTG 600
            D  G+GPY GV DGRILKW GE+ GW +FA ++ +R +C    + ++E  CGRPLGL F+KK+GDLY  D Y G+  VGP+GGLA +VV E EGQ   F N MDI E+ED IYF D S  +       A L G+KTG
Sbjct:   85 DPRGEGPYVGVTDGRILKWSGEDLGWIEFAYSSPHRKNCS---SHKVEPACGRPLGLSFEKKSGDLYFCDGYLGVMKVGPKGGLAEKVVDEVEGQKVMFANQMDIDEEEDAIYFNDSSDTYHFGDVFYAFLCGEKTG 218          
The following BLAST results are available for this feature:
BLAST of FE672044 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
STS1_ARATH3.518e-3245.95Strictosidine synthase 1 OS=Arabidopsis thaliana G... [more]
STSY_RAUSE3.880e-2736.36Strictosidine synthase OS=Rauvolfia serpentina GN=... [more]
STSY_RAUMA3.880e-2736.36Strictosidine synthase (Fragment) OS=Rauvolfia man... [more]
STS3_ARATH8.631e-2641.78Strictosidine synthase 3 OS=Arabidopsis thaliana G... [more]
STSY_CATRO2.631e-2536.23Strictosidine synthase OS=Catharanthus roseus GN=S... [more]
APMAP_DANRE2.689e-1939.02Adipocyte plasma membrane-associated protein OS=Da... [more]
APMAP_HUMAN1.130e-1736.61Adipocyte plasma membrane-associated protein OS=Ho... [more]
APMAP_SALSA1.476e-1737.80Adipocyte plasma membrane-associated protein OS=Sa... [more]
APMAP_CHICK1.927e-1735.98Adipocyte plasma membrane-associated protein OS=Ga... [more]
APMAP_BOVIN1.927e-1736.61Adipocyte plasma membrane-associated protein OS=Bo... [more]
back to top
BLAST of FE672044 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9T2X5_RICCO3.877e-7671.26Strictosidine synthase, putative OS=Ricinus commun... [more]
D7TIN1_VITVI7.887e-7470.11Whole genome shotgun sequence of line PN40024, sca... [more]
B9IHS3_POPTR1.430e-6872.07Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q4V3D9_ARATH7.811e-6868.82At3g57030 OS=Arabidopsis thaliana GN=At3g57030 PE=... [more]
Q0WST9_ARATH7.811e-6868.82Putative uncharacterized protein At3g57030 OS=Arab... [more]
Q9M1J5_ARATH7.812e-6868.82Putative uncharacterized protein F24I3.110 OS=Arab... [more]
D7LVM7_ARALY1.732e-6768.24Strictosidine synthase family protein OS=Arabidops... [more]
A7WPL3_TOBAC5.009e-6764.53Strictosidine synthase-like protein OS=Nicotiana t... [more]
Q9LKW1_SOLLC2.376e-5455.43Putative strictosidine synthase OS=Solanum lycoper... [more]
D7SSZ3_VITVI3.322e-5059.33Whole genome shotgun sequence of line PN40024, sca... [more]
back to top
BLAST of FE672044 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G57030.15.392e-7068.82| Symbols: | Calcium-dependent phosphotriesterase... [more]
AT1G08470.12.925e-4957.93| Symbols: SSL3 | strictosidine synthase-like 3 | ... [more]
AT5G22020.11.390e-4854.95| Symbols: | Calcium-dependent phosphotriesterase... [more]
AT2G41290.11.556e-4756.49| Symbols: SSL2 | strictosidine synthase-like 2 | ... [more]
AT3G57020.13.106e-4547.49| Symbols: | Calcium-dependent phosphotriesterase... [more]
AT3G57010.11.783e-4250.30| Symbols: | Calcium-dependent phosphotriesterase... [more]
AT3G57020.24.618e-4044.69| Symbols: | Calcium-dependent phosphotriesterase... [more]
AT3G59530.24.956e-3850.32| Symbols: LAP3 | Calcium-dependent phosphotrieste... [more]
AT3G59530.14.956e-3850.32| Symbols: LAP3 | Calcium-dependent phosphotrieste... [more]
AT2G41300.12.460e-3752.55| Symbols: SSL1 | strictosidine synthase-like 1 | ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004141Strictosidine synthasePANTHERPTHR10426STRICTOSIDINE SYNTHASE-RELATEDcoord: 46..200
score: 3.9
IPR011042Six-bladed beta-propeller, TolB-likeGENE3D2.120.10.30no descriptioncoord: 45..200
score: 4.9
IPR018119Strictosidine synthase, conserved regionPFAMPF03088Str_synthcoord: 164..201
score: 2.2
NoneNo IPR availablePANTHERPTHR10426:SF5STRICTOSIDINE SYNTHASEcoord: 46..200
score: 3.9
NoneNo IPR availableSEGsegsegcoord: 9..23
score
NoneNo IPR availableSUPERFAMILY63829Calcium-dependent phosphotriesterasecoord: 17..181
score: 2.9

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>FE672044 ID=FE672044|Name=FE672044|organism=Cicer arietinum|type=EST|length=669bp
GGCTGCAGGAATTCGAATTCCAAACTCATCGCCGCTGCAACTTTGCTTGC
AATCCTAACCATCATCATCTCCTTATTCAACCCACAAAACCTCTTTGTAC
CGATTACGATTCCTGGATCCAAGGACGACCTCCACGCTGCTCGGATACTC
CACGTCTCCGGAGCCGTCGGTCCGGAGAGTCTTGCCTTCGACGGTAACGG
TCAAGGTCCTTACACAGGCGTCGCCGATGGTCGGATTCTTAAGTGGGAAG
GGGAGGAACGAGGTTGGACTCAATTTGCTCTCACTACTTCCAATAGGTCG
GATTGTGTACGTCCAATCGCACTAGAGTTGGAGCATGTTTGTGGGAGGCC
ACTAGGACTAAAGTTTGATAAGAAAAATGGAGATCTTTACATTGCTGATG
CCTACTTTGGCCTCAATGTGGTAGGACCTGAAGGGGGTTTGGCCACTCAG
GTAGTAACAGAAGCTGAAGGCCAGCCCTTTCGCTTCACCAATGACATGGA
CATCAGTGAAGATGAAGATGTGATTTACTTCACTGATTTCAGCACAGTCT
TCCAGAGAAGGCAGTTTATGCTTGCACTTCTTAGTGGAGACAAGACCGGG
CCGATTAATGAAATATGATAAGTCAACAAAAGAAGTGAAGGTCTTATTAA
GAGGCCTTGCTTTTGCCAA
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Biological Process
TermDefinition
GO:0009058biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0016844strictosidine synthase activity
Vocabulary: INTERPRO
TermDefinition
IPR004141Strictosidine_synthase
IPR0110426-blade_b-propeller_TolB-like
IPR018119Strictosidine_synth_cons-reg