GO660536
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GO660536 vs. TrEMBL
Match: Q2QQD3_ORYSJ (Expressed protein OS=Oryza sativa subsp. japonica GN=LOC_Os12g31440 PE=4 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.342e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = -2 Query: 31 TRP*ALEDITALFYDEERNEIYTGNRHGLVHVWSN 135 T P ALED+TALFYDE+RNEIYTGNRHGLVHVWSN Sbjct: 454 TIPEALEDVTALFYDEDRNEIYTGNRHGLVHVWSN 488
BLAST of GO660536 vs. TrEMBL
Match: A3CHJ9_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_36171 PE=4 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.342e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = -2 Query: 31 TRP*ALEDITALFYDEERNEIYTGNRHGLVHVWSN 135 T P ALED+TALFYDE+RNEIYTGNRHGLVHVWSN Sbjct: 377 TIPEALEDVTALFYDEDRNEIYTGNRHGLVHVWSN 411
BLAST of GO660536 vs. TrEMBL
Match: Q9M387_ARATH (Putative uncharacterized protein F24B22.150 OS=Arabidopsis thaliana GN=F24B22.150 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 424 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 454
BLAST of GO660536 vs. TrEMBL
Match: Q9C5G8_ARATH (AT3g54190/F24B22_150 OS=Arabidopsis thaliana GN=At3g54190 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 437 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 467
BLAST of GO660536 vs. TrEMBL
Match: D7T4U0_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_67.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00032872001 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 434 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 464
BLAST of GO660536 vs. TrEMBL
Match: D7LUR4_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_906825 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 437 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 467
BLAST of GO660536 vs. TrEMBL
Match: C6TAN3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 209 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 239
BLAST of GO660536 vs. TrEMBL
Match: B9S4I5_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0690530 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 252 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 282
BLAST of GO660536 vs. TrEMBL
Match: B9S1V3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1323040 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 440 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 470
BLAST of GO660536 vs. TrEMBL
Match: B9N1R5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_784330 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 444 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 474
BLAST of GO660536 vs. TAIR peptide
Match: AT3G54190.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr3:20061759-20063880 REVERSE LENGTH=467) HSP 1 Score: 69.707 bits (169), Expect = 4.146e-13 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGLVHVWSN Sbjct: 437 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 467
BLAST of GO660536 vs. TAIR peptide
Match: AT2G38630.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr2:16154283-16156302 REVERSE LENGTH=467) HSP 1 Score: 68.5514 bits (166), Expect = 9.235e-13 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123 ALEDITALFYDEERNEIYTGNRHGL+HVWSN Sbjct: 437 ALEDITALFYDEERNEIYTGNRHGLLHVWSN 467 The following BLAST results are available for this feature:
BLAST of GO660536 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GO660536 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GO660536 ID=GO660536; Name=GO660536; organism=Cicer arietinum; type=EST; length=181bpback to top |