GR402742
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR402742 vs. SwissProt
Match: FAD3E_PHAAU (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Phaseolus aureus GN=ARG1 PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.477e-14 Identity = 33/43 (76.74%), Postives = 39/43 (90.70%), Query Frame = -1 Query: 175 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLHENTWTK 303 GP PFHLLKY QS+SQDHFVSD+GDIV+YQTD KLH+++WTK Sbjct: 336 GPLPFHLLKYLLQSISQDHFVSDTGDIVYYQTDPKLHQDSWTK 378
BLAST of GR402742 vs. SwissProt
Match: FAD3E_SOYBN (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Glycine max GN=FAD3 PE=2 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 5.435e-9 Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = -1 Query: 193 PFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTD-LKLH 300 P PFHL+KY QSM QDHFVSD+GD+V+YQTD L LH Sbjct: 340 PLPFHLIKYLIQSMRQDHFVSDTGDVVYYQTDSLLLH 376
BLAST of GR402742 vs. SwissProt
Match: FAD3E_TOBAC (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Nicotiana tabacum GN=FAD3 PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 4.601e-8 Identity = 24/33 (72.73%), Postives = 28/33 (84.85%), Query Frame = -1 Query: 205 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTD 303 GP PFHL+K +SM QDH+VSDSG+IVFYQTD Sbjct: 336 GPIPFHLVKDLTRSMKQDHYVSDSGEIVFYQTD 368
BLAST of GR402742 vs. TrEMBL
Match: Q9FXK9_SOYBN (Microsomal omega-3 fatty acid desaturase OS=Glycine max GN=FAD3C PE=2 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 3.734e-11 Identity = 29/43 (67.44%), Postives = 37/43 (86.05%), Query Frame = -1 Query: 175 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLHENTWTK 303 GP P HL+KY S+SQDHFVSDSGDIV+YQTD +LH+++WT+ Sbjct: 336 GPLPLHLIKYLLHSISQDHFVSDSGDIVYYQTDSQLHKDSWTQ 378
BLAST of GR402742 vs. TrEMBL
Match: B5LSX5_SOYBN (Microsomal omega-3 fatty acid desaturase OS=Glycine max GN=FAD3 PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.734e-11 Identity = 29/43 (67.44%), Postives = 37/43 (86.05%), Query Frame = -1 Query: 175 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLHENTWTK 303 GP P HL+KY S+SQDHFVSDSGDIV+YQTD +LH+++WT+ Sbjct: 336 GPLPLHLIKYLLHSISQDHFVSDSGDIVYYQTDSQLHKDSWTQ 378
BLAST of GR402742 vs. TrEMBL
Match: B3GCK6_SOYBN (Omega-3 fatty acid desaturase OS=Glycine max GN=FAD3C PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.734e-11 Identity = 29/43 (67.44%), Postives = 37/43 (86.05%), Query Frame = -1 Query: 175 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLHENTWTK 303 GP P HL+KY S+SQDHFVSDSGDIV+YQTD +LH+++WT+ Sbjct: 336 GPLPLHLIKYLLHSISQDHFVSDSGDIVYYQTDSQLHKDSWTQ 378
BLAST of GR402742 vs. TrEMBL
Match: C6TKV5_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.086e-10 Identity = 28/43 (65.12%), Postives = 35/43 (81.40%), Query Frame = -1 Query: 175 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLHENTWTK 303 GP P HL+KY S+SQDHFVSD GDIV+YQTD + H+++WTK Sbjct: 337 GPLPLHLIKYLLHSISQDHFVSDYGDIVYYQTDFQFHKDSWTK 379
BLAST of GR402742 vs. TrEMBL
Match: Q68Y59_SOYBN (Microsomal omega-3 fatty acid desaturase OS=Glycine max GN=GmFAD3-2b PE=2 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 1.853e-10 Identity = 28/43 (65.12%), Postives = 35/43 (81.40%), Query Frame = -1 Query: 175 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLHENTWTK 303 GP P HL+KY S+SQDHFVSD GDIV+YQTD + H+++WTK Sbjct: 337 GPLPLHLIKYLLHSISQDHFVSDYGDIVYYQTDSQFHKDSWTK 379
BLAST of GR402742 vs. TrEMBL
Match: B3GCK5_SOYBN (Omega-3 fatty acid desaturase OS=Glycine max GN=FAD3C PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.853e-10 Identity = 28/43 (65.12%), Postives = 35/43 (81.40%), Query Frame = -1 Query: 175 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLHENTWTK 303 GP P HL+KY S+SQDHFVSD GDIV+YQTD + H+++WTK Sbjct: 336 GPLPLHLIKYLLHSISQDHFVSDYGDIVYYQTDSQFHKDSWTK 378
BLAST of GR402742 vs. TrEMBL
Match: B6CI31_VIGUN (Microsomal omega-3 fatty acid desaturase OS=Vigna unguiculata GN=FAD3 PE=2 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 1.017e-8 Identity = 25/38 (65.79%), Postives = 32/38 (84.21%), Query Frame = -1 Query: 187 PFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLHEN 300 P PFHL+KY QSM +DHFVSD+GD+V+YQTD LH++ Sbjct: 334 PIPFHLIKYLMQSMREDHFVSDTGDVVYYQTDPHLHQD 371
BLAST of GR402742 vs. TrEMBL
Match: Q84X84_SOYBN (Microsomal omega-3-fatty acid desaturase OS=Glycine max GN=FAD3A PE=2 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.590e-8 Identity = 27/39 (69.23%), Postives = 32/39 (82.05%), Query Frame = -1 Query: 187 PFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTD-LKLHEN 300 P PFHL+KY QSM QDHFVSD+GD+V+YQTD L LH + Sbjct: 336 PLPFHLIKYLIQSMRQDHFVSDTGDVVYYQTDSLHLHSH 374
BLAST of GR402742 vs. TrEMBL
Match: B3F7U7_SOYBN (Microsomal omega-3 fatty acid desaturase A OS=Glycine max GN=FAD3A PE=2 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.590e-8 Identity = 27/39 (69.23%), Postives = 32/39 (82.05%), Query Frame = -1 Query: 187 PFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTD-LKLHEN 300 P PFHL+KY QSM QDHFVSD+GD+V+YQTD L LH + Sbjct: 336 PLPFHLIKYLIQSMRQDHFVSDTGDVVYYQTDSLHLHSH 374
BLAST of GR402742 vs. TrEMBL
Match: A4UHR9_SOYBN (Microsomal omega three fatty acid desaturase OS=Glycine max GN=FAD3A PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 8.607e-8 Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = -1 Query: 193 PFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTD-LKLH 300 P PFHL+KY QSM QDHFVSD+GD+V+YQTD L LH Sbjct: 336 PLPFHLIKYLIQSMRQDHFVSDTGDVVYYQTDSLHLH 372
BLAST of GR402742 vs. TAIR peptide
Match: AT5G05580.1 (| Symbols: FAD8 | fatty acid desaturase 8 | chr5:1664331-1666345 FORWARD LENGTH=435) HSP 1 Score: 51.9878 bits (123), Expect = 8.935e-8 Identity = 22/37 (59.46%), Postives = 28/37 (75.68%), Query Frame = -1 Query: 193 GPFPFHLLKYFQQSMSQDHFVSDSGDIVFYQTDLKLH 303 GP P HLL +SM QDHFVSD+GD+V+Y+ D KL+ Sbjct: 395 GPLPLHLLGSLIKSMKQDHFVSDTGDVVYYEADPKLN 431 The following BLAST results are available for this feature:
BLAST of GR402742 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 3
BLAST of GR402742 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GR402742 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR402742 ID=GR402742; Name=GR402742; organism=Cicer arietinum; type=EST; length=303bpback to top |