GR912559

EST Overview
NameGR912559
Unique NameGR912559
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length459
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
InterProScan analysis for Cicer arietinum unigene v12010-12-29
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of GR912559 vs. TrEMBL
Match: D7U498_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_44.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00026435001 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 4.537e-62
Identity = 115/147 (78.23%), Postives = 135/147 (91.84%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESFKPPKTCTTVSWTFRGFYEKALLDYERH  +GGEL+VP++S  EP++VENQAS SGRARR AA +AM+GWHSQRLLGNGEV DPIIKD++S+++QKREKQLK+I LLKRKKPS +++AVKAAR+K +KPQLDTAVVDIGPPA
Sbjct:   51 QVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTRGGELSVPVSSLAEPMNVENQASGSGRARRDAAARAMQGWHSQRLLGNGEVGDPIIKDKSSISLQKREKQLKNIGLLKRKKPSNLEHAVKAARTKAAKPQLDTAVVDIGPPA 197          
BLAST of GR912559 vs. TrEMBL
Match: B9SRA7_RICCO (Transcription factor, putative OS=Ricinus communis GN=RCOM_0613120 PE=3 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.246e-60
Identity = 112/147 (76.19%), Postives = 128/147 (87.07%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESFKPPKTCTTVSWTFRGFYEKALLDYERH   GGELN+P+ S PEPV V+NQ   SGRARR AA +AM+GWHSQRLLGNGEVSD IIKD+NSV +QKREKQLK++ ++KRKKPSYM++AVKAAR+K SKPQLD  VVD+G PA
Sbjct:  419 QVGESFKPPKTCTTVSWTFRGFYEKALLDYERHKTNGGELNLPLTSNPEPVIVDNQTPGSGRARRDAAARAMQGWHSQRLLGNGEVSDAIIKDKNSVPMQKREKQLKNLGIVKRKKPSYMEHAVKAARAKTSKPQLDVEVVDLGSPA 565          
BLAST of GR912559 vs. TrEMBL
Match: D7L9D8_ARALY (ARID/BRIGHT DNA-binding domain-containing protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_480624 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 4.558e-46
Identity = 95/148 (64.19%), Postives = 116/148 (78.38%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSI-NLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF+PPKTCTTVSWTFRGFYEKALL+YERH + GGEL +P+    EP++++NQAS SGRARR AA +AM+GWHSQRL GNGEVSD  IKD+N V  QKREKQ+ +   LLKRK+P+  ++  K A  + SKP LD  VVD+GPPA
Sbjct:  561 QVGESFRPPKTCTTVSWTFRGFYEKALLEYERHKVSGGELQIPLPLELEPMNIDNQASGSGRARRDAAARAMQGWHSQRLNGNGEVSDSAIKDKNLVIHQKREKQIGTTPGLLKRKRPA--EHGAKNA-IQVSKPMLDVTVVDVGPPA 705          
BLAST of GR912559 vs. TrEMBL
Match: Q940Y3_ARATH (At2g17400 OS=Arabidopsis thaliana GN=At2g17400 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 4.266e-44
Identity = 93/148 (62.84%), Postives = 113/148 (76.35%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSI-NLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF+PPKTCTTVSWTFRGFYEKALL+YERH +  GEL +P+    EP++++NQAS SGRARR AA +AM+GWHSQRL GNGEVSDP IKD+N V  QKREKQ+ +   LLKRK+ +  ++  K A    SK  LD  VVD+GPPA
Sbjct:  551 QVGESFRPPKTCTTVSWTFRGFYEKALLEYERHKVSEGELQIPLPLELEPMNIDNQASGSGRARRDAASRAMQGWHSQRLNGNGEVSDPAIKDKNLVLHQKREKQIGTTPGLLKRKRAA--EHGAKNA-IHVSKSMLDVTVVDVGPPA 695          
BLAST of GR912559 vs. TrEMBL
Match: B9I0L2_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_888397 PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.241e-43
Identity = 92/155 (59.35%), Postives = 115/155 (74.19%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERH--NIKGGELNVPI------ASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF PPKTCTTVSWTFRGFYEK LLDYERH  N   GEL+ P+            ++ + QAS SGR RR AA +AM+GWHS R LGNGEVS PI+KD+N++ +QKREK+LK++ LLKRKKPSY+++AVK+ RSK ++  LD  V D+G PA
Sbjct:   85 QVGESFNPPKTCTTVSWTFRGFYEKVLLDYERHITNADAGELSYPLLFIVFLVPTLSLLAGDIQASGSGRTRRDAAARAMQGWHSLRFLGNGEVSSPIVKDKNTIPLQKREKELKNLGLLKRKKPSYVEHAVKSPRSKSAR--LDVEVTDVGTPA 237          
BLAST of GR912559 vs. TrEMBL
Match: Q67YT6_ARATH (Putative uncharacterized protein At2g17400 OS=Arabidopsis thaliana GN=At2g17400 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.117e-43
Identity = 92/148 (62.16%), Postives = 112/148 (75.68%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSI-NLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF+PPKTCTTVSWTFRGFYEKALL+YERH +  GEL +P+    EP++++NQAS SGRARR AA +AM+GWHSQRL GNGEVSDP IKD+N V  QKREKQ+ +    LKRK+ +  ++  K A    SK  LD  VVD+GPPA
Sbjct:  551 QVGESFRPPKTCTTVSWTFRGFYEKALLEYERHKVSEGELQIPLPLELEPMNIDNQASGSGRARRDAASRAMQGWHSQRLNGNGEVSDPAIKDKNLVLHQKREKQIGTTPGSLKRKRAA--EHGAKNA-IHVSKSMLDVTVVDVGPPA 695          
BLAST of GR912559 vs. TrEMBL
Match: B9RKY3_RICCO (Transcription factor, putative OS=Ricinus communis GN=RCOM_1565520 PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 8.045e-43
Identity = 90/152 (59.21%), Postives = 109/152 (71.71%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASVS-----GRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF+PPKTCTTVSWTFR FYEKALL+YE+H ++ GEL        EP+ VENQA  S     GRARR AA +AM GWHSQRLLGNG+V  PIIKD+N  +  K +K LK+  LLKRKKPS ++ +V     K  KPQ+D+ V+DIGPPA
Sbjct:  272 QVGESFRPPKTCTTVSWTFRIFYEKALLEYEKHKMRNGELPFSDGPLTEPIRVENQAPGSQALGSGRARRDAAARAMEGWHSQRLLGNGQVCHPIIKDKNLNSTPKGDKLLKTNGLLKRKKPSSVERSVLVPHMKAMKPQVDSMVIDIGPPA 423          
BLAST of GR912559 vs. TrEMBL
Match: B2CZF7_LOTJA (ARID/BRIGHT DNA binding domain containing protein OS=Lotus japonicus GN=SIP1 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 4.881e-40
Identity = 88/153 (57.52%), Postives = 112/153 (73.20%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASV-----SGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLL-KRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF PPKTCTTVSWTFR FYEKALL+YE+H  + GEL +P+   P+P SVE + +V     SGRARR AA +AM+GWH+QRLLG GEV++P+IKD+N     KREK LKSI  + K++ PS +++  KAA     + QL TAVVD+GPPA
Sbjct:  182 QVGESFHPPKTCTTVSWTFRIFYEKALLEYEKHKREIGELQLPVGVFPQPSSVEKETTVYQAPGSGRARRDAAARAMQGWHAQRLLGYGEVAEPVIKDKNFNPTTKREKNLKSIGAINKQRTPSVLEHVEKAANIDGDR-QLVTAVVDVGPPA 333          
BLAST of GR912559 vs. TrEMBL
Match: Q69XV5_ORYSJ (DNA-binding protein-like OS=Oryza sativa subsp. japonica GN=P0040H10.36-1 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.855e-39
Identity = 86/152 (56.58%), Postives = 112/152 (73.68%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQ----ASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKK-PSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESFKPPKTCTTVSWTFR FYEKALL+YE+H I+ GE  V  ++  E ++ E+Q    AS SGRARR +A +AM+GWHSQRLLGNGE++DPIIKD+ +V+V K++K  KS    KRK+ P+  D+ +     KP K Q D+ V+D+GPPA
Sbjct:  221 QVGESFKPPKTCTTVSWTFRNFYEKALLEYEKHKIETGEFQVAASNLTERITSESQVGIHASGSGRARRESATRAMQGWHSQRLLGNGEIADPIIKDKGTVSVLKKDKTPKSSGSAKRKRTPTLEDDRI--VPYKPDKLQNDSMVLDLGPPA 370          
BLAST of GR912559 vs. TrEMBL
Match: B8B4P3_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_23739 PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.164e-39
Identity = 86/152 (56.58%), Postives = 111/152 (73.03%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQ----ASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKK-PSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESFKPPKTCTTVSWTFR FYEKALL+YE+H I+ GE  V  ++  E ++ E+Q    AS SGRARR +A +AM+GWHSQRLLGNGE++DPIIKD+ +V V K++K  KS    KRK+ P+  D+ +     KP K Q D+ V+D+GPPA
Sbjct:  221 QVGESFKPPKTCTTVSWTFRNFYEKALLEYEKHKIETGEFQVAASNLTERITSESQVGIHASGSGRARRESATRAMQGWHSQRLLGNGEIADPIIKDKGTVPVLKKDKTPKSSGSAKRKRTPTLEDDRI--VPYKPDKLQNDSMVLDLGPPA 370          
BLAST of GR912559 vs. TAIR peptide
Match: AT2G17410.1 (| Symbols: | ARID/BRIGHT DNA-binding domain-containing protein | chr2:7559869-7563474 FORWARD LENGTH=786)

HSP 1 Score: 180.644 bits (457), Expect = 3.187e-46
Identity = 93/148 (62.84%), Postives = 113/148 (76.35%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSI-NLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF+PPKTCTTVSWTFRGFYEKALL+YERH +  GEL +P+    EP++++NQAS SGRARR AA +AM+GWHSQRL GNGEVSDP IKD+N V  QKREKQ+ +   LLKRK+ +  ++  K A    SK  LD  VVD+GPPA
Sbjct:  551 QVGESFRPPKTCTTVSWTFRGFYEKALLEYERHKVSEGELQIPLPLELEPMNIDNQASGSGRARRDAASRAMQGWHSQRLNGNGEVSDPAIKDKNLVLHQKREKQIGTTPGLLKRKRAA--EHGAKNA-IHVSKSMLDVTVVDVGPPA 695          
BLAST of GR912559 vs. TAIR peptide
Match: AT2G17410.2 (| Symbols: | ARID/BRIGHT DNA-binding domain-containing protein | chr2:7559869-7563474 FORWARD LENGTH=780)

HSP 1 Score: 179.874 bits (455), Expect = 5.436e-46
Identity = 92/148 (62.16%), Postives = 110/148 (74.32%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVPIASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSI-NLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF+PPKTCTTVSWTFRGFYEKALL+YERH +  GEL +P+    EP++++NQAS SGRARR AA +AM+GWHSQRL GNGEVSDP IKD+N V  QKREKQ+ +   LLKRK         +AA      P+LD  VVD+GPPA
Sbjct:  551 QVGESFRPPKTCTTVSWTFRGFYEKALLEYERHKVSEGELQIPLPLELEPMNIDNQASGSGRARRDAASRAMQGWHSQRLNGNGEVSDPAIKDKNLVLHQKREKQIGTTPGLLKRK---------RAAEHVVVFPRLDVTVVDVGPPA 689          
BLAST of GR912559 vs. TAIR peptide
Match: AT1G76510.2 (| Symbols: | ARID/BRIGHT DNA-binding domain-containing protein | chr1:28708927-28712498 REVERSE LENGTH=434)

HSP 1 Score: 144.05 bits (362), Expect = 3.305e-35
Identity = 81/152 (53.29%), Postives = 105/152 (69.08%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVP-IASPP----EPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF PPKTCTTVSWTFR FYEKALL+YE+H  + GELN+P  AS P    E  +  +QAS SGR RR AA +AM+GWHSQRLLG+GEV++PI+K++   +  K +K LK+I + K+K  + MD       S  S+ Q    V+D+GPPA
Sbjct:  199 QVGESFHPPKTCTTVSWTFRIFYEKALLEYEKHLRQNGELNLPGSASLPSSGIEKEASSHQASGSGRTRRDAAARAMQGWHSQRLLGSGEVTEPIVKEKGLNSTPK-QKNLKNIGVQKQKTTTGMD----LVFSHESEKQSTAEVIDVGPPA 345          
BLAST of GR912559 vs. TAIR peptide
Match: AT1G76510.1 (| Symbols: | ARID/BRIGHT DNA-binding domain-containing protein | chr1:28708927-28712498 REVERSE LENGTH=434)

HSP 1 Score: 144.05 bits (362), Expect = 3.305e-35
Identity = 81/152 (53.29%), Postives = 105/152 (69.08%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVP-IASPP----EPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF PPKTCTTVSWTFR FYEKALL+YE+H  + GELN+P  AS P    E  +  +QAS SGR RR AA +AM+GWHSQRLLG+GEV++PI+K++   +  K +K LK+I + K+K  + MD       S  S+ Q    V+D+GPPA
Sbjct:  199 QVGESFHPPKTCTTVSWTFRIFYEKALLEYEKHLRQNGELNLPGSASLPSSGIEKEASSHQASGSGRTRRDAAARAMQGWHSQRLLGSGEVTEPIVKEKGLNSTPK-QKNLKNIGVQKQKTTTGMD----LVFSHESEKQSTAEVIDVGPPA 345          
BLAST of GR912559 vs. TAIR peptide
Match: AT1G20910.1 (| Symbols: | ARID/BRIGHT DNA-binding domain-containing protein | chr1:7277209-7280635 REVERSE LENGTH=398)

HSP 1 Score: 138.658 bits (348), Expect = 1.389e-33
Identity = 77/152 (50.66%), Postives = 101/152 (66.45%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEKALLDYERHNIKGGELNVP-----IASPPEPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF PPKTCTTVS+TFR FYEKALL+YE+     GELN+P     ++S  E     +Q S SGRARR +A +AM+GWH+QRL+G+GEV+ P +KD+  ++  K  K+LKSI L K K+ + MD+ V     K    QL   VVD+GP A
Sbjct:  163 QVGESFNPPKTCTTVSYTFRNFYEKALLEYEKCLRNNGELNLPGSTLILSSSVEKEPSSHQGSGSGRARRDSAARAMQGWHAQRLVGSGEVTAPAVKDKGLISTPK-HKKLKSIGLQKHKQQTSMDHVVTNEADK----QLAAEVVDVGPVA 309          
BLAST of GR912559 vs. TAIR peptide
Match: AT1G76510.3 (| Symbols: | ARID/BRIGHT DNA-binding domain-containing protein | chr1:28708681-28712498 REVERSE LENGTH=493)

HSP 1 Score: 130.954 bits (328), Expect = 2.896e-31
Identity = 81/175 (46.29%), Postives = 105/175 (60.00%), Query Frame = 3
Query:   18 RAGESFKPPKTCTTVSWTFRGFYEK-----------------------ALLDYERHNIKGGELNVP-IASPP----EPVSVENQASVSGRARRYAAEQAMRGWHSQRLLGNGEVSDPIIKDRNSVAVQKREKQLKSINLLKRKKPSYMDNAVKAARSKPSKPQLDTAVVDIGPPA 458
            + GESF PPKTCTTVSWTFR FYEK                       ALL+YE+H  + GELN+P  AS P    E  +  +QAS SGR RR AA +AM+GWHSQRLLG+GEV++PI+K++   +  K +K LK+I + K+K  + MD       S  S+ Q    V+D+GPPA
Sbjct:  199 QVGESFHPPKTCTTVSWTFRIFYEKVNFIFGLSTEYALILMRLYLFSLALLEYEKHLRQNGELNLPGSASLPSSGIEKEASSHQASGSGRTRRDAAARAMQGWHSQRLLGSGEVTEPIVKEKGLNSTPK-QKNLKNIGVQKQKTTTGMD----LVFSHESEKQSTAEVIDVGPPA 368          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
D7U498_VITVI4.537e-6278.23Whole genome shotgun sequence of line PN40024, sca... [more]
B9SRA7_RICCO4.246e-6076.19Transcription factor, putative OS=Ricinus communis... [more]
D7L9D8_ARALY4.558e-4664.19ARID/BRIGHT DNA-binding domain-containing protein ... [more]
Q940Y3_ARATH4.266e-4462.84At2g17400 OS=Arabidopsis thaliana GN=At2g17400 PE=... [more]
B9I0L2_POPTR1.241e-4359.35Predicted protein (Fragment) OS=Populus trichocarp... [more]
Q67YT6_ARATH2.117e-4362.16Putative uncharacterized protein At2g17400 OS=Arab... [more]
B9RKY3_RICCO8.045e-4359.21Transcription factor, putative OS=Ricinus communis... [more]
B2CZF7_LOTJA4.881e-4057.52ARID/BRIGHT DNA binding domain containing protein ... [more]
Q69XV5_ORYSJ1.855e-3956.58DNA-binding protein-like OS=Oryza sativa subsp. ja... [more]
B8B4P3_ORYSI3.164e-3956.58Putative uncharacterized protein OS=Oryza sativa s... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 6
Match NameE-valueIdentityDescription
AT2G17410.13.187e-4662.84| Symbols: | ARID/BRIGHT DNA-binding domain-conta... [more]
AT2G17410.25.436e-4662.16| Symbols: | ARID/BRIGHT DNA-binding domain-conta... [more]
AT1G76510.23.305e-3553.29| Symbols: | ARID/BRIGHT DNA-binding domain-conta... [more]
AT1G76510.13.305e-3553.29| Symbols: | ARID/BRIGHT DNA-binding domain-conta... [more]
AT1G20910.11.389e-3350.66| Symbols: | ARID/BRIGHT DNA-binding domain-conta... [more]
AT1G76510.32.896e-3146.29| Symbols: | ARID/BRIGHT DNA-binding domain-conta... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001606ARID/BRIGHT DNA-binding domainGENE3D1.10.150.60no descriptioncoord: 8..49
score: 0.0

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GR912559 ID=GR912559|Name=GR912559|organism=Cicer arietinum|type=EST|length=459bp
GATTTCGAGCGGCCGCCCGGGCAGGTGAGTCTTTCAAACCTCCAAAGACA
TGCACCACAGTTTCCTGGACTTTCCGGGGATTTTATGAGAAGGCCCTTCT
TGATTACGAAAGGCATAACATAAAAGGTGGCGAGCTGAATGTGCCTATCG
CTTCTCCTCCAGAGCCCGTGAGTGTTGAAAATCAGGCTTCAGTATCAGGT
AGAGCCCGAAGATATGCTGCTGAACAGGCTATGCGGGGTTGGCACTCACA
ACGTCTTCTTGGCAACGGTGAAGTTAGTGACCCTATTATAAAGGATAGGA
ATTCTGTGGCTGTGCAAAAGCGTGAAAAGCAGCTTAAGAGCATCAATTTA
CTTAAACGTAAGAAACCGTCTTATATGGATAATGCAGTCAAAGCAGCACG
CAGCAAACCATCTAAACCACAGTTGGATACAGCCGTGGTTGATATTGGAC
CTCCTGCTG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: INTERPRO
TermDefinition
IPR001606ARID_dom