GR915932

EST Overview
NameGR915932
Unique NameGR915932
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length460
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
InterProScan analysis for Cicer arietinum unigene v12010-12-29
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of GR915932 vs. TrEMBL
Match: D7KWZ3_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_315930 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 5.965e-22
Identity = 56/70 (80.00%), Postives = 62/70 (88.57%), Query Frame = 1
Query:   22 QVAGIGSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            Q+ G GSD   STLKNETV RK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLS+N++GGMQQ+ +G
Sbjct:  689 QIEG-GSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNG 757          
BLAST of GR915932 vs. TrEMBL
Match: B9HXI5_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_226120 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 5.965e-22
Identity = 56/65 (86.15%), Postives = 58/65 (89.23%), Query Frame = 1
Query:   37 GSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            G  L  STLKNETVSRK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGG+Q + SG
Sbjct:  653 GGGLGSSTLKNETVSRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGIQCDNSG 717          
BLAST of GR915932 vs. TrEMBL
Match: Q9LQA1_ARATH (F4N2.17 OS=Arabidopsis thaliana PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 7.791e-22
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
Query:   37 GSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            GSD   STLKNETV RK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLS+N++GGMQQ+ +G
Sbjct:  693 GSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNG 757          
BLAST of GR915932 vs. TrEMBL
Match: Q8VYC1_ARATH (Putative serine threonine kinase OS=Arabidopsis thaliana GN=At1g69220 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 7.791e-22
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
Query:   37 GSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            GSD   STLKNETV RK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLS+N++GGMQQ+ +G
Sbjct:  657 GSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNG 721          
BLAST of GR915932 vs. TrEMBL
Match: Q56WZ7_ARATH (Serine/threonine kinase OS=Arabidopsis thaliana GN=At1g69220 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 7.791e-22
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
Query:   37 GSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            GSD   STLKNETV RK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLS+N++GGMQQ+ +G
Sbjct:  172 GSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNG 236          
BLAST of GR915932 vs. TrEMBL
Match: Q56WD6_ARATH (Serine/threonine kinase (Fragment) OS=Arabidopsis thaliana GN=At1g69220 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 7.791e-22
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
Query:   37 GSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            GSD   STLKNETV RK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLS+N++GGMQQ+ +G
Sbjct:  265 GSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNG 329          
BLAST of GR915932 vs. TrEMBL
Match: O24527_ARATH (Putative serine/threonine kinase; 70789-76610 OS=Arabidopsis thaliana GN=SIK1 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 7.791e-22
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
Query:   37 GSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            GSD   STLKNETV RK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLS+N++GGMQQ+ +G
Sbjct:  684 GSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNG 748          
BLAST of GR915932 vs. TrEMBL
Match: B9REC4_RICCO (Serine/threonine protein kinase, putative OS=Ricinus communis GN=RCOM_1620250 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 8.614e-21
Identity = 55/74 (74.32%), Postives = 63/74 (85.14%), Query Frame = 1
Query:    7 ERPPGQVAGIGSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETS 225
            + P G+   +G+    STLKNETVS+K FALQDKLWSIYAAGNTVPIPFL+ATDISPIALLSDNVLGGMQ++ S
Sbjct:  655 QSPVGRSGVMGT----STLKNETVSKKAFALQDKLWSIYAAGNTVPIPFLKATDISPIALLSDNVLGGMQRDNS 724          
BLAST of GR915932 vs. TrEMBL
Match: D7T9Y1_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00012233001 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.583e-20
Identity = 54/70 (77.14%), Postives = 57/70 (81.43%), Query Frame = 1
Query:   22 QVAGIGSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            QV   G  +  S LKNETVSR  FA QDKLWSIYAAGNTVPIPFLRATDISPIALLS NVLGG Q+E+SG
Sbjct:  653 QVQAGGGGVSSSQLKNETVSRTAFASQDKLWSIYAAGNTVPIPFLRATDISPIALLSGNVLGGRQRESSG 722          
BLAST of GR915932 vs. TrEMBL
Match: A5BJC5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_038204 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.583e-20
Identity = 54/70 (77.14%), Postives = 57/70 (81.43%), Query Frame = 1
Query:   22 QVAGIGSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            QV   G  +  S LKNETVSR  FA QDKLWSIYAAGNTVPIPFLRATDISPIALLS NVLGG Q+E+SG
Sbjct: 1229 QVQAGGGGVSSSQLKNETVSRTAFASQDKLWSIYAAGNTVPIPFLRATDISPIALLSGNVLGGRQRESSG 1298          
BLAST of GR915932 vs. TAIR peptide
Match: AT1G69220.2 (| Symbols: SIK1 | Protein kinase superfamily protein | chr1:26020298-26026119 REVERSE LENGTH=809)

HSP 1 Score: 106.686 bits (265), Expect = 5.830e-24
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
Query:   37 GSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            GSD   STLKNETV RK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLS+N++GGMQQ+ +G
Sbjct:  657 GSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNG 721          
BLAST of GR915932 vs. TAIR peptide
Match: AT1G69220.1 (| Symbols: SIK1 | Protein kinase superfamily protein | chr1:26020298-26026119 REVERSE LENGTH=836)

HSP 1 Score: 106.686 bits (265), Expect = 5.830e-24
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
Query:   37 GSDLRKSTLKNETVSRK-FALQDKLWSIYAAGNTVPIPFLRATDISPIALLSDNVLGGMQQETSG 228
            GSD   STLKNETV RK FALQDKLWSIYAAGNTVPIPFLRATDISPIALLS+N++GGMQQ+ +G
Sbjct:  684 GSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNG 748          
BLAST of GR915932 vs. TAIR peptide
Match: AT3G02468.1 (| Symbols: CPuORF9 | conserved peptide upstream open reading frame 9 | chr3:509815-510068 FORWARD LENGTH=52)

HSP 1 Score: 70.4774 bits (171), Expect = 4.644e-13
Identity = 29/36 (80.56%), Postives = 35/36 (97.22%), Query Frame = -3
Query:  237 LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS 344
            LFYEAPLGYSIED+RPNGGIKKF+S+ YSNC+++PS
Sbjct:   17 LFYEAPLGYSIEDVRPNGGIKKFKSSVYSNCSKRPS 52          
BLAST of GR915932 vs. TAIR peptide
Match: AT5G15948.1 (| Symbols: CPuORF10 | conserved peptide upstream open reading frame 10 | chr5:5206432-5206587 FORWARD LENGTH=51)

HSP 1 Score: 65.0846 bits (157), Expect = 1.951e-11
Identity = 28/36 (77.78%), Postives = 33/36 (91.67%), Query Frame = -3
Query:  237 LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS 344
            L YEAPLGYSIED+RP GGIKKF+S+ YSNCA++PS
Sbjct:   16 LCYEAPLGYSIEDVRPFGGIKKFKSSVYSNCAKRPS 51          
BLAST of GR915932 vs. TAIR peptide
Match: AT3G25572.1 (| Symbols: CPuORF11 | conserved peptide upstream open reading frame 11 | chr3:9288595-9288871 REVERSE LENGTH=54)

HSP 1 Score: 65.0846 bits (157), Expect = 1.951e-11
Identity = 30/36 (83.33%), Postives = 32/36 (88.89%), Query Frame = -3
Query:  237 LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS 344
            LF+EAPL YSIED+RPNGGIKKFRSAAYSN   KPS
Sbjct:   19 LFFEAPLRYSIEDVRPNGGIKKFRSAAYSNITGKPS 54          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
D7KWZ3_ARALY5.965e-2280.00Putative uncharacterized protein OS=Arabidopsis ly... [more]
B9HXI5_POPTR5.965e-2286.15Predicted protein (Fragment) OS=Populus trichocarp... [more]
Q9LQA1_ARATH7.791e-2283.08F4N2.17 OS=Arabidopsis thaliana PE=4 SV=1[more]
Q8VYC1_ARATH7.791e-2283.08Putative serine threonine kinase OS=Arabidopsis th... [more]
Q56WZ7_ARATH7.791e-2283.08Serine/threonine kinase OS=Arabidopsis thaliana GN... [more]
Q56WD6_ARATH7.791e-2283.08Serine/threonine kinase (Fragment) OS=Arabidopsis ... [more]
O24527_ARATH7.791e-2283.08Putative serine/threonine kinase; 70789-76610 OS=A... [more]
B9REC4_RICCO8.614e-2174.32Serine/threonine protein kinase, putative OS=Ricin... [more]
D7T9Y1_VITVI5.583e-2077.14Whole genome shotgun sequence of line PN40024, sca... [more]
A5BJC5_VITVI5.583e-2077.14Putative uncharacterized protein OS=Vitis vinifera... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 5
Match NameE-valueIdentityDescription
AT1G69220.25.830e-2483.08| Symbols: SIK1 | Protein kinase superfamily prote... [more]
AT1G69220.15.830e-2483.08| Symbols: SIK1 | Protein kinase superfamily prote... [more]
AT3G02468.14.644e-1380.56| Symbols: CPuORF9 | conserved peptide upstream op... [more]
AT5G15948.11.951e-1177.78| Symbols: CPuORF10 | conserved peptide upstream o... [more]
AT3G25572.11.951e-1183.33| Symbols: CPuORF11 | conserved peptide upstream o... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 11..20
score
NoneNo IPR availableSEGsegsegcoord: 14..31
score
IPR012511S-adenosyl-l-methionine decarboxylase leader peptidePFAMPF08132AdoMetDC_leadercoord: 12..67
score: 4.4

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GR915932 ID=GR915932|Name=GR915932|organism=Cicer arietinum|type=EST|length=460bp
GATTTCGAGCGGCCGCCCGGGCAGGTAGCTGGAATTGGTAGTGATTTAAG
GAAGAGCACACTGAAGAATGAAACAGTCAGCCGCAAATTTGCTTTACAAG
ATAAGCTTTGGTCCATTTATGCCGCTGGTAATACTGTGCCTATACCATTC
TTAAGGGCTACAGATATATCTCCTATTGCTCTCCTTTCAGACAATGTGCT
TGGCGGCATGCAACAGGAAACCAGTGGGGAATATCAGGATGGCTTGCGAG
CACAGTTGGAGTAAGCAGCTGATCTGAATTTCTTGATTCCACCGTTAGGA
CGAATGTCTTCAATGCTGTATCCGAGGGGGGCTTCGTAGAATAATGATGA
TGATGAATTACTACTACTACTACTAGACTTCTTTTTACCTCCTTTAGACT
CCATTAGCTCATTCAGTCCTGATTTGATAAGATCAAATTATAAAATGCCG
CAGCTTTCAA
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR012511AdoMetDC_leader