GR916960
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR916960 vs. TrEMBL
Match: A4Q7P8_MEDTR (VHS OS=Medicago truncatula GN=MtrDRAFT_AC183502g21v2 PE=4 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.948e-12 Identity = 33/39 (84.62%), Postives = 39/39 (100.00%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KE+RERLVVRRFKF+DPRIEQIQDLEN+M++YFREDLH+ Sbjct: 581 KEERERLVVRRFKFQDPRIEQIQDLENEMMKYFREDLHK 619
BLAST of GR916960 vs. TrEMBL
Match: B9T7P5_RICCO (Microtubule associated protein xmap215, putative OS=Ricinus communis GN=RCOM_0214170 PE=4 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 3.322e-12 Identity = 34/39 (87.18%), Postives = 38/39 (97.44%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KEDRER+VVRRFKFE+ RIEQIQDLENDM++YFREDLHR Sbjct: 1115 KEDRERMVVRRFKFEELRIEQIQDLENDMMKYFREDLHR 1153
BLAST of GR916960 vs. TrEMBL
Match: B9GIF2_POPTR (Microtubule organization protein OS=Populus trichocarpa GN=MOR2 PE=4 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.649e-11 Identity = 31/39 (79.49%), Postives = 39/39 (100.00%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KEDRER+VVRRFKFE+PR+EQ+QDLE+DM++YFREDL+R Sbjct: 1159 KEDRERMVVRRFKFEEPRMEQVQDLESDMMKYFREDLNR 1197
BLAST of GR916960 vs. TrEMBL
Match: Q8S912_TOBAC (Microtubule bundling polypeptide TMBP200 OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 6.265e-11 Identity = 30/39 (76.92%), Postives = 38/39 (97.44%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 K +RER+VVRRFKFE+PR+EQIQDLE+D+++YFREDLHR Sbjct: 1150 KGERERIVVRRFKFEEPRLEQIQDLESDLMKYFREDLHR 1188
BLAST of GR916960 vs. TrEMBL
Match: B9I0T7_POPTR (Microtubule organization protein OS=Populus trichocarpa GN=MOR1 PE=4 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.183e-11 Identity = 31/39 (79.49%), Postives = 37/39 (94.87%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KEDRER+VVRRFKFE+PR+EQIQDLE DM++Y REDL+R Sbjct: 1152 KEDRERMVVRRFKFEEPRMEQIQDLEGDMMKYLREDLNR 1190
BLAST of GR916960 vs. TrEMBL
Match: D7TGA8_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_652.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00002244001 PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.543e-9 Identity = 30/39 (76.92%), Postives = 35/39 (89.74%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KEDRER+VVRRFKFE+ RIEQIQDLE D+++Y REDL R Sbjct: 109 KEDRERMVVRRFKFEELRIEQIQDLETDLMKYLREDLQR 147
BLAST of GR916960 vs. TrEMBL
Match: Q9ZQN6_ARATH (Similar to ch-TOG protein from Homo sapiens OS=Arabidopsis thaliana GN=At2g35630 PE=2 SV=2) HSP 1 Score: 63.5438 bits (153), Expect = 7.659e-9 Identity = 29/39 (74.36%), Postives = 35/39 (89.74%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KEDRER+VVRR KFE+ R EQIQDLENDM+++FREDL + Sbjct: 773 KEDRERVVVRRIKFEELRPEQIQDLENDMMKFFREDLQK 811
BLAST of GR916960 vs. TrEMBL
Match: Q94FN2_ARATH (MOR1/GEM1 OS=Arabidopsis thaliana GN=At2g35630 PE=2 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.659e-9 Identity = 29/39 (74.36%), Postives = 35/39 (89.74%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KEDRER+VVRR KFE+ R EQIQDLENDM+++FREDL + Sbjct: 1140 KEDRERVVVRRIKFEELRPEQIQDLENDMMKFFREDLQK 1178
BLAST of GR916960 vs. TrEMBL
Match: D7LII7_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_482523 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.964e-8 Identity = 28/39 (71.79%), Postives = 34/39 (87.18%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KEDRER+VVRR KFE+ R EQI DLENDM+++FREDL + Sbjct: 1139 KEDRERVVVRRIKFEELRPEQILDLENDMMKFFREDLQK 1177
BLAST of GR916960 vs. TAIR peptide
Match: AT2G35630.1 (| Symbols: MOR1, GEM1 | ARM repeat superfamily protein | chr2:14966828-14980361 FORWARD LENGTH=1978) HSP 1 Score: 63.5438 bits (153), Expect = 3.018e-11 Identity = 29/39 (74.36%), Postives = 35/39 (89.74%), Query Frame = 3 Query: 48 KEDRERLVVRRFKFEDPRIEQIQDLENDMLRYFREDLHR 164 KEDRER+VVRR KFE+ R EQIQDLENDM+++FREDL + Sbjct: 1140 KEDRERVVVRRIKFEELRPEQIQDLENDMMKFFREDLQK 1178 The following BLAST results are available for this feature:
BLAST of GR916960 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 9
BLAST of GR916960 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR916960 ID=GR916960; Name=GR916960; organism=Cicer arietinum; type=EST; length=166bpback to top |