HO063570
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO063570 vs. TAIR peptide
Match: AT3G06040.3 (| Symbols: | Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein | chr3:1824516-1825076 REVERSE LENGTH=186) HSP 1 Score: 50.447 bits (119), Expect = 6.784e-7 Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = -1 Query: 421 QVPAVLKQGVXKXEANSIIEKIKAAGGVAVME 516 +VPA+LKQGV K EAN II KIKA GG+AVME Sbjct: 155 KVPAILKQGVTKEEANEIIAKIKAVGGIAVME 186
BLAST of HO063570 vs. TAIR peptide
Match: AT3G06040.2 (| Symbols: | Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein | chr3:1824516-1825076 REVERSE LENGTH=186) HSP 1 Score: 50.447 bits (119), Expect = 6.784e-7 Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = -1 Query: 421 QVPAVLKQGVXKXEANSIIEKIKAAGGVAVME 516 +VPA+LKQGV K EAN II KIKA GG+AVME Sbjct: 155 KVPAILKQGVTKEEANEIIAKIKAVGGIAVME 186
BLAST of HO063570 vs. TAIR peptide
Match: AT3G06040.1 (| Symbols: | Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein | chr3:1824516-1825076 REVERSE LENGTH=186) HSP 1 Score: 50.447 bits (119), Expect = 6.784e-7 Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = -1 Query: 421 QVPAVLKQGVXKXEANSIIEKIKAAGGVAVME 516 +VPA+LKQGV K EAN II KIKA GG+AVME Sbjct: 155 KVPAILKQGVTKEEANEIIAKIKAVGGIAVME 186 The following BLAST results are available for this feature:
BLAST of HO063570 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO063570 ID=HO063570; Name=HO063570; organism=Cicer arietinum; type=EST; length=534bpback to top |