HO063570

EST Overview
NameHO063570
Unique NameHO063570
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length534
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
InterProScan analysis for Cicer arietinum unigene v12010-12-29
Libraries
Library NameType
LIBEST_026410 Chickpea drought stressed cDNA SSH library AR1cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO063570 vs. TAIR peptide
Match: AT3G06040.3 (| Symbols: | Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein | chr3:1824516-1825076 REVERSE LENGTH=186)

HSP 1 Score: 50.447 bits (119), Expect = 6.784e-7
Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = -1
Query:  421 QVPAVLKQGVXKXEANSIIEKIKAAGGVAVME 516
            +VPA+LKQGV K EAN II KIKA GG+AVME
Sbjct:  155 KVPAILKQGVTKEEANEIIAKIKAVGGIAVME 186          
BLAST of HO063570 vs. TAIR peptide
Match: AT3G06040.2 (| Symbols: | Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein | chr3:1824516-1825076 REVERSE LENGTH=186)

HSP 1 Score: 50.447 bits (119), Expect = 6.784e-7
Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = -1
Query:  421 QVPAVLKQGVXKXEANSIIEKIKAAGGVAVME 516
            +VPA+LKQGV K EAN II KIKA GG+AVME
Sbjct:  155 KVPAILKQGVTKEEANEIIAKIKAVGGIAVME 186          
BLAST of HO063570 vs. TAIR peptide
Match: AT3G06040.1 (| Symbols: | Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein | chr3:1824516-1825076 REVERSE LENGTH=186)

HSP 1 Score: 50.447 bits (119), Expect = 6.784e-7
Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = -1
Query:  421 QVPAVLKQGVXKXEANSIIEKIKAAGGVAVME 516
            +VPA+LKQGV K EAN II KIKA GG+AVME
Sbjct:  155 KVPAILKQGVTKEEANEIIAKIKAVGGIAVME 186          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT3G06040.36.784e-775.00| Symbols: | Ribosomal protein L12/ ATP-dependent... [more]
AT3G06040.26.784e-775.00| Symbols: | Ribosomal protein L12/ ATP-dependent... [more]
AT3G06040.16.784e-775.00| Symbols: | Ribosomal protein L12/ ATP-dependent... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 25..38
score

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO063570 ID=HO063570|Name=HO063570|organism=Cicer arietinum|type=EST|length=534bp
CGGGGGAAACAACAATGACAAAGCATACATTAAAAATTTAAAACACTATA
CAGAATCTAAAATAAGAGGCACAATTCTAGATAAAAGGTTCATTAATCTA
AAGTCTAAACAGAAGACCAACAATTTTGGTATATCAACCNCAAGCATCTC
AAATAACTAAATGTAAATTCCATACATAATTTTTCCTANGGTTCANAAAT
TTTTCATTTGTAAGAAAAGATGTGAGNGTTACAAATGTCAAACTAACNCA
ACAATTACATGNGATAGAGTAATTAACCAGAGAACTCTGACTAAAAAAAT
TTATTCNCGTCTTCAGAAATTTCTAACCATTCATTCNCCATGGATATGGT
ATCTTCAAAGCACATCAGCCATCAAGAAAAATTTGNGATCTTGGCCAAAA
TCAAATAACTGAAAAATCTACTCCATAACTGCAACTCCTCCAGCCGCTTT
TATTTTTTCTATAATACTATTTGCTTCCNCTTTTGNGACNCCTTGTTTAA
GGACAGCGGGTACCTGCCCGGGCGGCCGCTCGAA
back to top