HO067523

EST Overview
NameHO067523
Unique NameHO067523
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length679
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO067523 vs. SwissProt
Match: YOCS_BACSU (Uncharacterized sodium-dependent transporter yocS OS=Bacillus subtilis GN=yocS PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.027e-18
Identity = 68/230 (29.57%), Postives = 108/230 (46.96%), Query Frame = -3
Query:    3 FPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTG------IGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVL-VAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGYVPA 671
            FP   TW ++ Y    LG +MF +G+     DF E   +P ++  G   Q+ + PL+           FGL  G      I  G++LVGC  G   SN  TFL     A LS+ +T++ST  A  VTP        + LPV    +  SI Q V+ P+ AGL++  FF +        LP +SV+ + AI +        + ++S  G+ I  +++  +   ++ G++ A
Sbjct:   29 FPSLFTWISS-YITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIGVIAQYTIMPLVA----------FGLAFGLHLPAEIAVGVILVGCCPGGTASNVMTFLAKGNTA-LSVAVTTISTLLAPVVTPLLIMLFAKEWLPVSPGSLFISILQAVLFPIIAGLIVKMFFRKQVAKAVHALPLVSVIGIVAIVSAVVSGNRENLLQS--GLLIFSVVILHNGIGYLLGFLCA 244          
BLAST of HO067523 vs. SwissProt
Match: SOAT_BOVIN (Solute carrier family 10 member 6 OS=Bos taurus GN=SLC10A6 PE=2 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 1.506e-9
Identity = 54/200 (27.00%), Postives = 92/200 (46.00%), Query Frame = -3
Query:   39 LGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTP-----XXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAF 623
            +G LMF++G +   +       RP  IA G   QF + PL+ YL  I     F L       ++++GC  G  +SN  TF  D  M  LSI MT+ ST +A+ + P           + + L +  + +  ++  +++ PVA G+ +N  +P+    I         L+  +  GA + L    +K      I+LL+++F
Sbjct:   42 IGLLMFSLGCSVEVQKLWGHIRRPWGIAVGMLCQFGLMPLIAYLLII----SFSLKPLQAIAVLIMGCCPGGTVSNIFTFWVDGDM-DLSISMTTCSTMAALGMMPLCLYLYTLSWNLEQNLTIPYQNIGITLVCLII-PVAFGIYVNYRWPKQSKIILKIGAIAGGLLFLVVTGAGMVL----MKEFWSSDIILLMISF 231          
BLAST of HO067523 vs. SwissProt
Match: SOAT_MOUSE (Solute carrier family 10 member 6 OS=Mus musculus GN=Slc10a6 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.967e-9
Identity = 59/216 (27.31%), Postives = 101/216 (46.76%), Query Frame = -3
Query:    9 APALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTP-----XXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPR---ICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGYV 632
            A  +G +MF+ G +   +       RP  IA G   QF + PL  YL  I     FGL       ++++G   G  +SN  TF  D  M  LSI MT+ ST +A+ + P           + + L +  + +  ++  +VV PVA+G+ +N  +P+   +   +   L  + +LV A+  G  LA   +   + L +S +  LV  H++ F+  ++
Sbjct:   39 AVMVGLVMFSFGCSVESQKLWLHLRRPWGIAVGLLSQFGLMPLTAYLLAI----GFGLKPFQAIAVLMMGSCPGGTISNVLTFWVDGDM-DLSISMTTCSTVAALGMMPLCLYIYTRSWTLTQNLVIPYQSIGITLVSLVV-PVASGVYVNYRWPKQATVILKVGAILGGMLLLVVAV-TGMVLAKGWNTDVTLLVISCIFPLVG-HVTGFLLAFL 246          
BLAST of HO067523 vs. SwissProt
Match: NTCP2_HUMAN (Ileal sodium/bile acid cotransporter OS=Homo sapiens GN=SLC10A2 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.382e-9
Identity = 46/154 (29.87%), Postives = 73/154 (47.40%), Query Frame = -3
Query:  180 LGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQI------VVAPVAAGLLLNRFFPR 623
            L  +MF++G N   K FL    RP  I  G+  QF + PL G++  +     F +L      ++++GC  G   SN   +  D  M  LS+ MT+ ST  A+ + P     LI  ++ VD   +V     I      +V PV+ G+ +N  +P+
Sbjct:   42 LALVMFSMGCNVEIKKFLGHIKRPWGICVGFLCQFGIMPLTGFILSV----AFDILPLQAVVVLIIGCCPGGTASNILAYWVDGDM-DLSVSMTTCSTLLALGMMP--LCLLIYTKMWVDSGSIVIPYDNIGTSLVALVVPVSIGMFVNHKWPQ 188          
BLAST of HO067523 vs. SwissProt
Match: SOAT_RAT (Solute carrier family 10 member 6 OS=Rattus norvegicus GN=Slc10a6 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 9.762e-9
Identity = 65/230 (28.26%), Postives = 104/230 (45.22%), Query Frame = -3
Query:    3 SLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTP-----XXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPF---LPPLSVLVAAICAGAPLA--LNIDCIKSPLGVSILLLLVAFHLSAFIAGYVPA 662
            SL    T   A  +G +MF+ G +   +       RP  IA G   QF + PL  YL  I     FGL       ++++G   G  +SN  TF  D  M  LSI MT+ ST +A+ + P           + + L +  + +  ++  +VV PVA+G+ +N  +P+    I      +  + +LV A+  G  LA   NID       V++L++   F L   + G++ A
Sbjct:   29 SLKLVFTVLSAVMVGLVMFSFGCSVESRKLWLHLRRPWGIAVGLLCQFGLMPLTAYLLAI----GFGLKPFQAIAVLIMGSCPGGTVSNVLTFWVDGDM-DLSISMTTCSTVAALGMMPLCLYVYTRSWTLPQSLTIPYQSIGITLVSLVV-PVASGIYVNYRWPKQATFILKVGAAVGGMLLLVVAV-TGVVLAKGWNID-------VTLLVISCIFPLVGHVMGFLLA 244          
BLAST of HO067523 vs. SwissProt
Match: NTCP2_RABIT (Ileal sodium/bile acid cotransporter OS=Oryctolagus cuniculus GN=SLC10A2 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.275e-8
Identity = 44/154 (28.57%), Postives = 73/154 (47.40%), Query Frame = -3
Query:  180 LGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQI------VVAPVAAGLLLNRFFPR 623
            L  +MF++G N   K FL    RP  I  G+  QF + PL G++  +     FG++      ++++GC  G   SN   +  D  M  LS+ MT+ ST  A+ + P      +  ++ VD   +V     I      +V PV+ G+ +N  +P+
Sbjct:   43 LALVMFSMGCNVEIKKFLGHIRRPWGIFIGFLCQFGIMPLTGFVLAV----AFGIMPIQAVVVLIMGCCPGGTASNILAYWVDGDM-DLSVSMTTCSTLLALGMMP--LCLYVYTKMWVDSGTIVIPYDNIGTSLVALVVPVSIGMFVNHKWPQ 189          
BLAST of HO067523 vs. SwissProt
Match: NTCP2_CRIGR (Ileal sodium/bile acid cotransporter OS=Cricetulus griseus GN=SLC10A2 PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 3.709e-8
Identity = 45/154 (29.22%), Postives = 71/154 (46.10%), Query Frame = -3
Query:  180 LGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQI------VVAPVAAGLLLNRFFPR 623
            L  +MF++G N     FL    RP  I  G+  QF + PL G++  +     FG+L      +++ GC  G   SN   +  D  M  LS+ MT+ ST  A+ + P      I  ++ VD   +V     I      +V PV+ G+ +N  +P+
Sbjct:   42 LALVMFSMGCNVELHKFLGHLRRPWGIVVGFLCQFGIMPLTGFVLSV----AFGILPVQAVVVLIQGCCPGGTASNILAYWVDGDM-DLSVSMTTCSTLLALGMMP--LCLFIYTKMWVDSGTIVIPYDSIGTSLVALVIPVSIGMYVNHKWPQ 188          
BLAST of HO067523 vs. SwissProt
Match: SOAT_HUMAN (Solute carrier family 10 member 6 OS=Homo sapiens GN=SLC10A6 PE=1 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 4.845e-8
Identity = 59/215 (27.44%), Postives = 96/215 (44.65%), Query Frame = -3
Query:   21 LGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTP-----XXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFP---RICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAF------HLSAFI 623
            +G LMF++G +   +       RP  IA G   QF + P   YL  I     F L       ++++GC  G  +SN  TF  D  M  LSI MT+ ST +A+ + P           + + L +  + +  ++  + + PVA G+ +N  +P   +I   I   +  + +LV A+ AG  LA      K      I LL ++F      H++ F+
Sbjct:   42 MGLLMFSLGCSVEIRKLWSHIRRPWGIAVGLLCQFGLMPFTAYLLAI----SFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDM-DLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTI-PVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAV-AGVVLA------KGSWNSDITLLTISFIFPLIGHVTGFL 243          
BLAST of HO067523 vs. SwissProt
Match: NTCP2_RAT (Ileal sodium/bile acid cotransporter OS=Rattus norvegicus GN=Slc10a2 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.841e-7
Identity = 44/154 (28.57%), Postives = 72/154 (46.75%), Query Frame = -3
Query:  180 LGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQI------VVAPVAAGLLLNRFFPR 623
            L  +MF++G N     FL    RP  I  G+  QF + PL G++  + +    G+L      ++++GC  G   SN   +  D  M  LS+ MT+ ST  A+ + P      I  ++ VD   +V     I      +V PV+ G+ +N  +P+
Sbjct:   42 LAMVMFSMGCNVEINKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVAS----GILPVQAVVVLIMGCCPGGTGSNILAYWIDGDM-DLSVSMTTCSTLLALGMMP--LCLFIYTKMWVDSGTIVIPYDSIGISLVALVIPVSIGMFVNHKWPQ 188          
BLAST of HO067523 vs. SwissProt
Match: NTCP2_MOUSE (Ileal sodium/bile acid cotransporter OS=Mus musculus GN=Slc10a2 PE=2 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 3.140e-7
Identity = 43/154 (27.92%), Postives = 72/154 (46.75%), Query Frame = -3
Query:  180 LGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQI------VVAPVAAGLLLNRFFPR 623
            L  +MF++G N     FL    RP  I  G+  QF + PL G++  + +    G+L      ++++GC  G   SN   +  D  M  LS+ MT+ ST  A+ + P      +  ++ VD   +V     I      +V PV+ G+ +N  +P+
Sbjct:   42 LAMVMFSMGCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVAS----GILPVQAVVVLIMGCCPGGTGSNILAYWIDGDM-DLSVSMTTCSTLLALGMMP--LCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGMFVNHKWPQ 188          
BLAST of HO067523 vs. TrEMBL
Match: C6TL76_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.037e-98
Identity = 182/223 (81.61%), Postives = 201/223 (90.13%), Query Frame = -3
Query:    9 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGYV 677
            LI+P SLTWFT+RYYAPALGFLMFAVGVNS+E DFLEAF RPAEI TGYFGQF VKPLLGYLF +IAV V  L T +GAGIVLV CVSGAQLS+YATFLTDPQMAPLSIVMTSLSTASAVFVTP     LIGK+LP+DV+GMV+SITQIVV P+AAGLLLNRF+PRICN IRPFLPPLSVLVA+ICAGAPLA N++ +KSPLGV ILLL+VAFHLS+FIAGY+
Sbjct:  108 LIYPPSLTWFTSRYYAPALGFLMFAVGVNSNENDFLEAFKRPAEIVTGYFGQFAVKPLLGYLFCMIAVTVLSLPTTVGAGIVLVACVSGAQLSSYATFLTDPQMAPLSIVMTSLSTASAVFVTPLLLLLLIGKKLPIDVRGMVYSITQIVVVPIAAGLLLNRFYPRICNVIRPFLPPLSVLVASICAGAPLAFNVETMKSPLGVVILLLVVAFHLSSFIAGYI 330          
BLAST of HO067523 vs. TrEMBL
Match: A5B5H0_VITVI (Putative uncharacterized protein (Fragment) OS=Vitis vinifera GN=VITISV_011475 PE=4 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 8.506e-93
Identity = 174/223 (78.03%), Postives = 192/223 (86.10%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFF-PRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            LI+P S TWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRP  I  GY GQFVVKPLLGYLF  IAV +FGL T IGAGI+L  CVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+AVFVTP     LIGKRLPVDVKGMV SI QIVVAP+AAGLLLNR+F PRICNAIRPFLPPLSVLV A C G+PLA+N++ + SP GV++ +L++AFH +AF+AGY
Sbjct:   32 LIYPPSFTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPMAIFAGYVGQFVVKPLLGYLFGTIAVTIFGLPTAIGAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATAVFVTPILSLLLIGKRLPVDVKGMVSSILQIVVAPIAAGLLLNRWFLPRICNAIRPFLPPLSVLVTACCVGSPLAINVESVLSPFGVTVSMLIIAFHFTAFVAGY 254          
BLAST of HO067523 vs. TrEMBL
Match: B9GVU7_POPTR (Bile acid:Na+ symporter family protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_413218 PE=4 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 1.895e-92
Identity = 174/222 (78.38%), Postives = 190/222 (85.59%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            L+ P S TWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPA I  GY GQFVVKP LGYLF II+V+VFGL T IGAGI+LV CVSGAQLSNYATFLTDP MAPLSIVMTS+STA+AVFVTP     LIGKRLPVDVKGMV SI QIVVAP+AAGLLLNR FP+I   IRPFLPPLSVLV A C GAPLA+N+D + SP GV+I+ L++AFHLSAF+ GY
Sbjct:   25 LVHPPSFTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAAILAGYVGQFVVKPSLGYLFGIISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPMAPLSIVMTSMSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSIMQIVVAPIAAGLLLNRLFPQISGVIRPFLPPLSVLVTACCVGAPLAINVDSVMSPFGVTIVSLIIAFHLSAFVVGY 246          
BLAST of HO067523 vs. TrEMBL
Match: B9RBV8_RICCO (Sodium-bile acid cotransporter, putative OS=Ricinus communis GN=RCOM_1681430 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 6.740e-90
Identity = 169/223 (75.78%), Postives = 189/223 (84.75%), Query Frame = -3
Query:    9 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGYV 677
            L++P S TWFTTRYYAPALGFLMFAVGVNSSEKDF+EAF RP+ I  GY GQF+VKP+LGY+F II+V+VF L T IGAGI+LV CVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+AVFVTP     LIGKRLPVDV GMV SI QIVVAP+AAGLLLNRF P I NAIRPFLPPLSVLV A C GAPLA+N+  + SP G +IL L+++FHL AF+AGYV
Sbjct:  119 LVYPPSFTWFTTRYYAPALGFLMFAVGVNSSEKDFVEAFKRPSAIFAGYLGQFIVKPILGYIFGIISVSVFNLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATAVFVTPLLSLLLIGKRLPVDVTGMVSSILQIVVAPIAAGLLLNRFLPWISNAIRPFLPPLSVLVTACCVGAPLAINVKSVISPFGATILSLIISFHLLAFVAGYV 341          
BLAST of HO067523 vs. TrEMBL
Match: Q650U0_ORYSJ (Os09g0520600 protein OS=Oryza sativa subsp. japonica GN=P0669G04.12 PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.836e-87
Identity = 160/222 (72.07%), Postives = 186/222 (83.78%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            L++P S TWFTTRYYAPALGFLMFAVGVNSS KDF+EA  RP  IA GY GQF++KP LG+LF  +AV +F L T +GAGI+LV CVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+AVFVTP     LIGK+LPVDVKGM+ SI QIVVAP+AAGLLLNR+ PR+C+AI+PFLPPLSV V A+C G+PLA+NI  + SP G++ +LLL AFH S+FIAGY
Sbjct:  107 LVYPPSFTWFTTRYYAPALGFLMFAVGVNSSVKDFIEAIQRPDAIAAGYVGQFIIKPFLGFLFGTLAVTIFNLPTALGAGIMLVSCVSGAQLSNYATFLTDPHMAPLSIVMTSLSTATAVFVTPTLSYFLIGKKLPVDVKGMMSSIVQIVVAPIAAGLLLNRYLPRLCSAIQPFLPPLSVFVTALCVGSPLAINIKAVLSPFGLATVLLLFAFHTSSFIAGY 328          
BLAST of HO067523 vs. TrEMBL
Match: B8BDK4_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_32074 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.836e-87
Identity = 160/222 (72.07%), Postives = 186/222 (83.78%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            L++P S TWFTTRYYAPALGFLMFAVGVNSS KDF+EA  RP  IA GY GQF++KP LG+LF  +AV +F L T +GAGI+LV CVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+AVFVTP     LIGK+LPVDVKGM+ SI QIVVAP+AAGLLLNR+ PR+C+AI+PFLPPLSV V A+C G+PLA+NI  + SP G++ +LLL AFH S+FIAGY
Sbjct:  107 LVYPPSFTWFTTRYYAPALGFLMFAVGVNSSVKDFIEAIQRPDAIAAGYVGQFIIKPFLGFLFGTLAVTIFNLPTALGAGIMLVSCVSGAQLSNYATFLTDPHMAPLSIVMTSLSTATAVFVTPTLSYFLIGKKLPVDVKGMMSSIVQIVVAPIAAGLLLNRYLPRLCSAIQPFLPPLSVFVTALCVGSPLAINIKAVLSPFGLATVLLLFAFHTSSFIAGY 328          
BLAST of HO067523 vs. TrEMBL
Match: B4FY15_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.930e-85
Identity = 158/222 (71.17%), Postives = 183/222 (82.43%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            L++P S TWFTTRYYAPALGFLMFAVGVNSS KDF+EA  RP  IA GY GQFV+KPL G+LF  +AV V  L   +GAGI+LV CVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+AVFVTP     LIG++LPVDVKGM+ SI QIVVAP+AAGLLLNRF PR+C AI+PFLP +SV V A+C G+PLA+NI  + SP G++I+LLL AFH S+F+AGY
Sbjct:  115 LVYPPSFTWFTTRYYAPALGFLMFAVGVNSSAKDFIEAIKRPDAIAAGYIGQFVIKPLFGFLFGTLAVAVLNLPAALGAGIMLVSCVSGAQLSNYATFLTDPHMAPLSIVMTSLSTATAVFVTPTLSYFLIGQKLPVDVKGMMSSIVQIVVAPIAAGLLLNRFLPRLCAAIQPFLPSMSVFVTALCVGSPLAINIKAVLSPFGLTIVLLLFAFHTSSFVAGY 336          
BLAST of HO067523 vs. TrEMBL
Match: B6TKE8_MAIZE (Bile acid sodium symporter OS=Zea mays PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.454e-84
Identity = 157/222 (70.72%), Postives = 182/222 (81.98%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            L++P S TWFTTRYYAPALGFLMFAVGVNSS  DF+EA  RP  IA GY GQFV+KPL G+LF  +AV V  L   +GAGI+LV CVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+AVFVTP     LIG++LPVDVKGM+ SI QIVVAP+AAGLLLNRF PR+C AI+PFLP +SV V A+C G+PLA+NI  + SP G++I+LLL AFH S+F+AGY
Sbjct:  115 LVYPPSFTWFTTRYYAPALGFLMFAVGVNSSANDFIEAIKRPDAIAAGYIGQFVIKPLFGFLFDTLAVAVLNLPAALGAGIMLVSCVSGAQLSNYATFLTDPHMAPLSIVMTSLSTATAVFVTPTLSYFLIGQKLPVDVKGMMSSIIQIVVAPIAAGLLLNRFLPRLCAAIQPFLPSMSVFVTALCVGSPLAINIKAVLSPFGLTIVLLLFAFHTSSFVAGY 336          
BLAST of HO067523 vs. TrEMBL
Match: D7MDZ7_ARALY (Bile acid:sodium symporter family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_914321 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 3.240e-84
Identity = 156/222 (70.27%), Postives = 185/222 (83.33%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            L++P S TWFT+RY+ PALGFLMFAVG+NS+EKDFLEAF RP  I  GY GQ++VKP+LG++F + AV+VF L T IGAGI+LV CVSGAQLSNYATFLTDP +APLSIVMTSLSTA+AV VTP     LIGK+LPVDVKGM+ SI Q+V+AP+AAGLLLN+ FP++ NAIRPFLP LSVL  A C GAPLALNI+ + SP G +ILLL+  FHLSAF+AGY
Sbjct:  110 LLYPPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAFKRPKAILLGYVGQYLVKPILGFIFGLAAVSVFQLPTPIGAGIMLVSCVSGAQLSNYATFLTDPALAPLSIVMTSLSTATAVLVTPMLSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLNKLFPKVSNAIRPFLPILSVLDTACCVGAPLALNINSVMSPFGATILLLVTMFHLSAFLAGY 331          
BLAST of HO067523 vs. TrEMBL
Match: Q8VYY4_ARATH (Putative uncharacterized protein OS=Arabidopsis thaliana GN=At4g22840 PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 5.527e-84
Identity = 156/222 (70.27%), Postives = 185/222 (83.33%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            LI+P S TWFT+RY+ PALGFLMFAVG+NS+EKDFLEAF RP  I  GY GQ++VKP+LG++F + AV++F L T IGAGI+LV CVSGAQLSNYATFLTDP +APLSIVMTSLSTA+AV VTP     LIGK+LPVDVKGM+ SI Q+V+AP+AAGLLLN+ FP++ NAIRPFLP LSVL  A C GAPLALNI+ + SP G +ILLL+  FHLSAF+AGY
Sbjct:  113 LIYPPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAFKRPKAILLGYVGQYLVKPVLGFIFGLAAVSLFQLPTPIGAGIMLVSCVSGAQLSNYATFLTDPALAPLSIVMTSLSTATAVLVTPMLSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLNKLFPKVSNAIRPFLPILSVLDTACCVGAPLALNINSVMSPFGATILLLVTMFHLSAFLAGY 334          
BLAST of HO067523 vs. TAIR peptide
Match: AT4G22840.1 (| Symbols: | Sodium Bile acid symporter family | chr4:11991636-11993676 REVERSE LENGTH=409)

HSP 1 Score: 314.309 bits (804), Expect = 3.802e-86
Identity = 156/222 (70.27%), Postives = 185/222 (83.33%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            LI+P S TWFT+RY+ PALGFLMFAVG+NS+EKDFLEAF RP  I  GY GQ++VKP+LG++F + AV++F L T IGAGI+LV CVSGAQLSNYATFLTDP +APLSIVMTSLSTA+AV VTP     LIGK+LPVDVKGM+ SI Q+V+AP+AAGLLLN+ FP++ NAIRPFLP LSVL  A C GAPLALNI+ + SP G +ILLL+  FHLSAF+AGY
Sbjct:  113 LIYPPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAFKRPKAILLGYVGQYLVKPVLGFIFGLAAVSLFQLPTPIGAGIMLVSCVSGAQLSNYATFLTDPALAPLSIVMTSLSTATAVLVTPMLSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLNKLFPKVSNAIRPFLPILSVLDTACCVGAPLALNINSVMSPFGATILLLVTMFHLSAFLAGY 334          
BLAST of HO067523 vs. TAIR peptide
Match: AT4G12030.2 (| Symbols: BAT5, BASS5 | bile acid transporter 5 | chr4:7210981-7212713 FORWARD LENGTH=407)

HSP 1 Score: 299.286 bits (765), Expect = 1.266e-81
Identity = 145/222 (65.32%), Postives = 177/222 (79.73%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            L++P S TWF  RY+ P LGF+MFAVG+NS+E+DFLEA  RP  I  GY GQ+++KPLLGY+F +IAV++F L T IGAGI+LV CVSGAQLSNY TFLTDP +A LSIVMTS+STA+AV VTP     LIGK+LPVDV GM+ SI Q+V+ P+AAGLLLNR FPR+ NAI+PFLP L+V+  + C GAPLALNID I SP G +IL L++ FHL AF+AGY
Sbjct:  114 LVYPPSFTWFKPRYFVPGLGFMMFAVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGVIAVSLFNLPTSIGAGIMLVSCVSGAQLSNYTTFLTDPSLAALSIVMTSISTATAVLVTPMLSLLLIGKKLPVDVFGMISSILQVVITPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMSCCIGAPLALNIDSILSPFGATILFLVITFHLLAFVAGY 335          
BLAST of HO067523 vs. TAIR peptide
Match: AT4G12030.1 (| Symbols: BAT5, BASS5 | bile acid transporter 5 | chr4:7211716-7212713 FORWARD LENGTH=273)

HSP 1 Score: 270.011 bits (689), Expect = 8.223e-73
Identity = 133/201 (66.17%), Postives = 162/201 (80.60%), Query Frame = -3
Query:   12 LMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 614
            +MFAVG+NS+E+DFLEA  RP  I  GY GQ+++KPLLGY+F +IAV++F L T IGAGI+LV CVSGAQLSNY TFLTDP +A LSIVMTS+STA+AV VTP     LIGK+LPVDV GM+ SI Q+V+ P+AAGLLLNR FPR+ NAI+PFLP L+V+  + C GAPLALNID I SP G +IL L++ FHL AF+AGY
Sbjct:    1 MMFAVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGVIAVSLFNLPTSIGAGIMLVSCVSGAQLSNYTTFLTDPSLAALSIVMTSISTATAVLVTPMLSLLLIGKKLPVDVFGMISSILQVVITPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMSCCIGAPLALNIDSILSPFGATILFLVITFHLLAFVAGY 201          
BLAST of HO067523 vs. TAIR peptide
Match: AT3G25410.1 (| Symbols: | Sodium Bile acid symporter family | chr3:9214565-9216331 REVERSE LENGTH=431)

HSP 1 Score: 164.851 bits (416), Expect = 3.725e-41
Identity = 86/222 (38.74%), Postives = 136/222 (61.26%), Query Frame = -3
Query:   12 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 677
            L +P S TW +   YAPALG +M ++G+  S  DF  AF RP  ++ G+  Q+V+KPLLG    ++  N FG+     AG +L  CV+GAQLS+YA+ L+   +A +SI++TS +T ++V  TP     LIG  +PVD   M  SI Q+V+ P+  GL+LN +   +   ++P +P ++++  ++C G+PL++N   I S  G+ +++ +V FH  AF  GY
Sbjct:  127 LSYPPSFTWVSKDLYAPALGGIMLSIGIQLSVDDFALAFKRPVPLSVGFVAQYVLKPLLG----VLVANAFGMPRTFYAGFILTCCVAGAQLSSYASSLSKADVA-MSILLTSSTTIASVIFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPITLGLVLNTYAKPVVTLLQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIVPIVTFHAVAFALGY 343          
BLAST of HO067523 vs. TAIR peptide
Match: AT2G26900.1 (| Symbols: | Sodium Bile acid symporter family | chr2:11475156-11477870 REVERSE LENGTH=409)

HSP 1 Score: 134.806 bits (338), Expect = 4.128e-32
Identity = 70/219 (31.96%), Postives = 117/219 (53.42%), Query Frame = -3
Query:   12 PLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGY 668
            P  +TW  T  +   LGFLM ++G+  + +DF      P  +  G+  Q+++KP+LG+L  +       L   +  G++LV C  G Q SN AT+++   +A LS++MT+ ST  A+ +TP     L G+ +PVD  G+  S  Q+V+ P   G+L N FFP+  + I    P + V++  +   +P+    D +K+  G  ++L +   H +AF  GY
Sbjct:  120 PSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYMIKPILGFLIAM----TLKLSAPLATGLILVSCCPGGQASNVATYISKGNVA-LSVLMTTCSTIGAIIMTPLLTKLLAGQLVPVDAAGLALSTFQVVLVPTIIGVLANEFFPKFTSKIITVTPLIGVILTTLLCASPIGQVADVLKTQ-GAQLILPVALLHAAAFAIGY 332          
BLAST of HO067523 vs. TAIR peptide
Match: AT1G78560.1 (| Symbols: | Sodium Bile acid symporter family | chr1:29546846-29548764 REVERSE LENGTH=401)

HSP 1 Score: 115.546 bits (288), Expect = 2.592e-26
Identity = 69/223 (30.94%), Postives = 110/223 (49.33%), Query Frame = -3
Query:    9 LIFPLSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLLTGIGAGIVLVGCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASAVFVTPXXXXXLIGKRLPVDVKGMVFSITQIVVAPVAAGLLLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAFIAGYV 677
            L+ P +  W T  +    L   M  +G+  +  D   A + P E+  G+  Q+ V PL  +        +  L     AG++LVGC  G   SN  T++    +A LS++MT+ ST SAV +TP     L  + + VD  G++ S  Q+V+ PV AG  LN++F ++   + P +PP++V   AI  G  +  N   I    G  ++L     H+S F+ GY+
Sbjct:  113 LMRPSTFNWVTPNWTIVGLTITMLGMGMTLTLDDLRGALSMPKELFAGFLLQYSVMPLSAFF----VSKLLNLPPHYAAGLILVGCCPGGTASNIVTYIARGNVA-LSVLMTAASTVSAVIMTPLLTAKLAKQYITVDALGLLMSTLQVVLLPVLAGAFLNQYFKKLVKFVSPVMPPIAVGTVAILCGYAIGQNASAILMS-GKQVVLASCLLHISGFLFGYL 329          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
YOCS_BACSU3.027e-1829.57Uncharacterized sodium-dependent transporter yocS ... [more]
SOAT_BOVIN1.506e-927.00Solute carrier family 10 member 6 OS=Bos taurus GN... [more]
SOAT_MOUSE1.967e-927.31Solute carrier family 10 member 6 OS=Mus musculus ... [more]
NTCP2_HUMAN4.382e-929.87Ileal sodium/bile acid cotransporter OS=Homo sapie... [more]
SOAT_RAT9.762e-928.26Solute carrier family 10 member 6 OS=Rattus norveg... [more]
NTCP2_RABIT1.275e-828.57Ileal sodium/bile acid cotransporter OS=Oryctolagu... [more]
NTCP2_CRIGR3.709e-829.22Ileal sodium/bile acid cotransporter OS=Cricetulus... [more]
SOAT_HUMAN4.845e-827.44Solute carrier family 10 member 6 OS=Homo sapiens ... [more]
NTCP2_RAT1.841e-728.57Ileal sodium/bile acid cotransporter OS=Rattus nor... [more]
NTCP2_MOUSE3.140e-727.92Ileal sodium/bile acid cotransporter OS=Mus muscul... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6TL76_SOYBN1.037e-9881.61Putative uncharacterized protein OS=Glycine max PE... [more]
A5B5H0_VITVI8.506e-9378.03Putative uncharacterized protein (Fragment) OS=Vit... [more]
B9GVU7_POPTR1.895e-9278.38Bile acid:Na+ symporter family protein (Fragment) ... [more]
B9RBV8_RICCO6.740e-9075.78Sodium-bile acid cotransporter, putative OS=Ricinu... [more]
Q650U0_ORYSJ1.836e-8772.07Os09g0520600 protein OS=Oryza sativa subsp. japoni... [more]
B8BDK4_ORYSI1.836e-8772.07Putative uncharacterized protein OS=Oryza sativa s... [more]
B4FY15_MAIZE2.930e-8571.17Putative uncharacterized protein OS=Zea mays PE=2 ... [more]
B6TKE8_MAIZE1.454e-8470.72Bile acid sodium symporter OS=Zea mays PE=2 SV=1[more]
D7MDZ7_ARALY3.240e-8470.27Bile acid:sodium symporter family protein OS=Arabi... [more]
Q8VYY4_ARATH5.527e-8470.27Putative uncharacterized protein OS=Arabidopsis th... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 6
Match NameE-valueIdentityDescription
AT4G22840.13.802e-8670.27| Symbols: | Sodium Bile acid symporter family | ... [more]
AT4G12030.21.266e-8165.32| Symbols: BAT5, BASS5 | bile acid transporter 5 |... [more]
AT4G12030.18.223e-7366.17| Symbols: BAT5, BASS5 | bile acid transporter 5 |... [more]
AT3G25410.13.725e-4138.74| Symbols: | Sodium Bile acid symporter family | ... [more]
AT2G26900.14.128e-3231.96| Symbols: | Sodium Bile acid symporter family | ... [more]
AT1G78560.12.592e-2630.94| Symbols: | Sodium Bile acid symporter family | ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 32..42
score
NoneNo IPR availableSEGsegsegcoord: 125..130
score
IPR002657Bile acid:sodium symporterPANTHERPTHR10361SODIUM-BILE ACID COTRANSPORTERcoord: 1..226
score: 3.3
IPR002657Bile acid:sodium symporterPFAMPF01758SBFcoord: 17..200
score: 3.2

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO067523 ID=HO067523|Name=HO067523|organism=Cicer arietinum|type=EST|length=679bp
CGGGCAGGTACATAACCAGCTATAAAAGCTGACAAATGAAAAGCAACAAG
AAGCAATAAGATTGAAACTCCAAGGGGAGATTTAATACAGTCAATGTTAA
GAGCGAGCGGTGCTCCAGCACAGATAGCTGCCACCAAAACGGATAGTGGA
GGCAAAAATGGTCGAATAGCATTACAAATACGAGGAAAGAAGCGATTTAG
AAGTAGGCCAGCTGCAACAGGAGCCACCACAATCTGTGTAATGCTAAACA
CCATTCCTTTAACATCTACAGGCAATCTCTTCCCAATGAGCAACAACAAT
AAGAGTGGCGTAACAAAAACCGCAGAAGCAGTTGACAGCGATGTCATTAC
TATGCTTAATGGTGCCATTTGTGGGTCTGTTAGAAAAGTAGCATAATTTG
AGAGCTGAGCACCACTAACACAACCTACCAATACAATCCCTGCGCCTATT
CCTGTTAGTAGACCAAAAACATTTACCGCAATAATATAAAACAGATATCC
CAGAAGAGGCTTCACAACAAACTGGCCAAAATAACCAGTGGCAATTTCTG
CCGGCCTATTAAACGCCTCAAGGAAGTCCTTTTCACTTGAATTGACCCCA
ACTGCAAACATCAAAAACCCTAATGCAGGTGCATAGTATCTGGTAGTAAA
CCAGGTTAAAGAAAGTGGGAAGATTAGAG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Biological Process
TermDefinition
GO:0006814sodium ion transport
Vocabulary: Molecular Function
TermDefinition
GO:0008508bile acid:sodium symporter activity
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR002657BilAc:Na_symport/Acr3