HO063294

EST Overview
NameHO063294
Unique NameHO063294
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length302
Libraries
Library NameType
LIBEST_026410 Chickpea drought stressed cDNA SSH library AR1cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO063294 vs. SwissProt
Match: GIT7_SCHPO (Glucose-insensitive transcription protein 7 OS=Schizosaccharomyces pombe GN=git7 PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.062e-12
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = -3
Query:  136 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKW 294
            +  +Y+NAD+D RRAM KS+ ESNGT LST+WK+V SK  E  PP+GME KK+
Sbjct:  327 FQNLYKNADDDTRRAMMKSYTESNGTALSTNWKDVKSKTFETKPPQGMEPKKF 379          
BLAST of HO063294 vs. SwissProt
Match: SUGT1_DICDI (Protein SUGT1 homolog OS=Dictyostelium discoideum GN=sugt1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.366e-12
Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = -3
Query:  133 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWE 294
            +  I+    ED +RAM KSF ES GTVLST+W EVGSKKV G PP+G+E K++E
Sbjct:  333 FRDIFSKGSEDQQRAMMKSFTESGGTVLSTNWDEVGSKKVVGEPPKGLEFKQYE 386          
BLAST of HO063294 vs. SwissProt
Match: SGT1_YEAST (Protein SGT1 OS=Saccharomyces cerevisiae GN=SGT1 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.270e-12
Identity = 31/50 (62.00%), Postives = 37/50 (74.00%), Query Frame = -3
Query:  136 IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKW 285
            +Y  AD D +RAM KSF+ESNGT LSTDW++V    V+ SPPEGME K W
Sbjct:  346 LYAGADPDTKRAMMKSFIESNGTALSTDWEDVSKGTVKTSPPEGMEPKHW 395          
BLAST of HO063294 vs. SwissProt
Match: SUGT1_HUMAN (Suppressor of G2 allele of SKP1 homolog OS=Homo sapiens GN=SUGT1 PE=1 SV=3)

HSP 1 Score: 65.855 bits (159), Expect = 7.610e-11
Identity = 28/50 (56.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  136 IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKW 285
            IY +  ++++RAM+KSF+ES GTVLST+W +VG +KVE +PP+ ME KK+
Sbjct:  316 IYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY 365          
BLAST of HO063294 vs. SwissProt
Match: SUGT1_BOVIN (Suppressor of G2 allele of SKP1 homolog OS=Bos taurus GN=SUGT1 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.610e-11
Identity = 28/50 (56.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  136 IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKW 285
            IY +  ++++RAM+KSF+ES GTVLST+W +VG +KVE +PP+ ME KK+
Sbjct:  289 IYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY 338          
BLAST of HO063294 vs. SwissProt
Match: SUGT1_RAT (Suppressor of G2 allele of SKP1 homolog OS=Rattus norvegicus GN=Sugt1 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.214e-10
Identity = 27/50 (54.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  136 IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKW 285
            IY +  ++++RAM+KSF+ES GTVLST+W +VG +KVE +PP+ ME K++
Sbjct:  287 IYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKQY 336          
BLAST of HO063294 vs. SwissProt
Match: SUGT1_MOUSE (Suppressor of G2 allele of SKP1 homolog OS=Mus musculus GN=Sugt1 PE=2 SV=3)

HSP 1 Score: 64.3142 bits (155), Expect = 2.214e-10
Identity = 27/50 (54.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  136 IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKW 285
            IY +  ++++RAM+KSF+ES GTVLST+W +VG +KVE +PP+ ME K++
Sbjct:  287 IYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKQY 336          
BLAST of HO063294 vs. TrEMBL
Match: B6EBD4_SOYBN (SGT1-1 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 9.510e-23
Identity = 51/55 (92.73%), Postives = 53/55 (96.36%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGME+KKWEY
Sbjct:  306 FRDIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMELKKWEY 360          
BLAST of HO063294 vs. TrEMBL
Match: C6TJ65_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.119e-22
Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGME+KKW+Y
Sbjct:  307 FRDIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMELKKWQY 361          
BLAST of HO063294 vs. TrEMBL
Match: B7FIH5_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.119e-22
Identity = 51/55 (92.73%), Postives = 52/55 (94.55%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IYQNADEDMR AMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY
Sbjct:  175 FRDIYQNADEDMRSAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 229          
BLAST of HO063294 vs. TrEMBL
Match: B9RCI2_RICCO (Chaperone binding protein, putative OS=Ricinus communis GN=RCOM_1689140 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.769e-20
Identity = 46/55 (83.64%), Postives = 51/55 (92.73%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IYQNADEDMRRAM KSF+ES+GTVLSTDWKEVGSKKVEGS PEGME++KWEY
Sbjct:  208 FRDIYQNADEDMRRAMMKSFVESSGTVLSTDWKEVGSKKVEGSAPEGMEMRKWEY 262          
BLAST of HO063294 vs. TrEMBL
Match: C5XEC3_SORBI (Putative uncharacterized protein Sb03g028430 OS=Sorghum bicolor GN=Sb03g028430 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.679e-19
Identity = 44/55 (80.00%), Postives = 52/55 (94.55%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IY++ADEDMRRAM KSF+ESNGTVLST+WK+VGSKKVEGSPP+GME+KKWEY
Sbjct:  310 FRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKKVEGSPPDGMELKKWEY 364          
BLAST of HO063294 vs. TrEMBL
Match: Q9SE32_ORYSA (Sgt1 OS=Oryza sativa GN=Sgt1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.192e-19
Identity = 44/55 (80.00%), Postives = 51/55 (92.73%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IY +ADEDMRRAM KSF+ESNGTVLST+WK+VGSKKVEGSPP+GME+KKWEY
Sbjct:  313 FRDIYSDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKKVEGSPPDGMELKKWEY 367          
BLAST of HO063294 vs. TrEMBL
Match: Q0JL44_ORYSJ (Os01g0624500 protein OS=Oryza sativa subsp. japonica GN=Os01g0624500 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.192e-19
Identity = 44/55 (80.00%), Postives = 51/55 (92.73%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IY +ADEDMRRAM KSF+ESNGTVLST+WK+VGSKKVEGSPP+GME+KKWEY
Sbjct:  313 FRDIYSDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKKVEGSPPDGMELKKWEY 367          
BLAST of HO063294 vs. TrEMBL
Match: B9RIR3_RICCO (Chaperone binding protein, putative OS=Ricinus communis GN=RCOM_1581910 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.192e-19
Identity = 44/55 (80.00%), Postives = 51/55 (92.73%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IYQ+ADED RRAM KSF+ESNGTVLST+WKEVGSKKVEGSPP+GME++KWEY
Sbjct:  307 FRDIYQDADEDTRRAMKKSFVESNGTVLSTNWKEVGSKKVEGSPPDGMEMRKWEY 361          
BLAST of HO063294 vs. TrEMBL
Match: B8ABY6_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_02921 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.192e-19
Identity = 44/55 (80.00%), Postives = 51/55 (92.73%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IY +ADEDMRRAM KSF+ESNGTVLST+WK+VGSKKVEGSPP+GME+KKWEY
Sbjct:  313 FRDIYSDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKKVEGSPPDGMELKKWEY 367          
BLAST of HO063294 vs. TrEMBL
Match: A6N0C5_ORYSI (Suppressor of g2 allele of skp1 (Fragment) OS=Oryza sativa subsp. indica PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.192e-19
Identity = 44/55 (80.00%), Postives = 51/55 (92.73%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            +  IY +ADEDMRRAM KSF+ESNGTVLST+WK+VGSKKVEGSPP+GME+KKWEY
Sbjct:   74 FRDIYSDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKKVEGSPPDGMELKKWEY 128          
BLAST of HO063294 vs. TAIR peptide
Match: AT4G11260.1 (| Symbols: ATSGT1B, ETA3, RPR1, EDM1, SGT1B | phosphatase-related | chr4:6851515-6853719 REVERSE LENGTH=358)

HSP 1 Score: 95.9005 bits (237), Expect = 5.412e-21
Identity = 42/55 (76.36%), Postives = 51/55 (92.73%), Query Frame = -3
Query:  130 YAGIYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWEY 294
            ++ IY +ADEDMRRAM+KSF ESNGTVLST+WKEVG+KKVE +PP+GME+KKWEY
Sbjct:  304 FSDIYSSADEDMRRAMNKSFAESNGTVLSTNWKEVGTKKVESTPPDGMELKKWEY 358          
BLAST of HO063294 vs. TAIR peptide
Match: AT4G23570.3 (| Symbols: SGT1A | phosphatase-related | chr4:12300015-12302493 FORWARD LENGTH=351)

HSP 1 Score: 93.5893 bits (231), Expect = 2.686e-20
Identity = 41/51 (80.39%), Postives = 49/51 (96.08%), Query Frame = -3
Query:  133 IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWE 285
            IYQNADEDMRRAMSKSF+ESNGTVLST+W+EVG+K +E +PP+GME+KKWE
Sbjct:  300 IYQNADEDMRRAMSKSFVESNGTVLSTNWQEVGTKTIESTPPDGMELKKWE 350          
BLAST of HO063294 vs. TAIR peptide
Match: AT4G23570.2 (| Symbols: SGT1A | phosphatase-related | chr4:12300015-12302493 FORWARD LENGTH=350)

HSP 1 Score: 93.5893 bits (231), Expect = 2.686e-20
Identity = 41/51 (80.39%), Postives = 49/51 (96.08%), Query Frame = -3
Query:  133 IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWE 285
            IYQNADEDMRRAMSKSF+ESNGTVLST+W+EVG+K +E +PP+GME+KKWE
Sbjct:  299 IYQNADEDMRRAMSKSFVESNGTVLSTNWQEVGTKTIESTPPDGMELKKWE 349          
BLAST of HO063294 vs. TAIR peptide
Match: AT4G23570.1 (| Symbols: SGT1A | phosphatase-related | chr4:12300015-12302493 FORWARD LENGTH=350)

HSP 1 Score: 93.5893 bits (231), Expect = 2.686e-20
Identity = 41/51 (80.39%), Postives = 49/51 (96.08%), Query Frame = -3
Query:  133 IYQNADEDMRRAMSKSFLESNGTVLSTDWKEVGSKKVEGSPPEGMEVKKWE 285
            IYQNADEDMRRAMSKSF+ESNGTVLST+W+EVG+K +E +PP+GME+KKWE
Sbjct:  299 IYQNADEDMRRAMSKSFVESNGTVLSTNWQEVGTKTIESTPPDGMELKKWE 349          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 7
Match NameE-valueIdentityDescription
GIT7_SCHPO1.062e-1260.38Glucose-insensitive transcription protein 7 OS=Sch... [more]
SUGT1_DICDI2.366e-1259.26Protein SUGT1 homolog OS=Dictyostelium discoideum ... [more]
SGT1_YEAST5.270e-1262.00Protein SGT1 OS=Saccharomyces cerevisiae GN=SGT1 P... [more]
SUGT1_HUMAN7.610e-1156.00Suppressor of G2 allele of SKP1 homolog OS=Homo sa... [more]
SUGT1_BOVIN7.610e-1156.00Suppressor of G2 allele of SKP1 homolog OS=Bos tau... [more]
SUGT1_RAT2.214e-1054.00Suppressor of G2 allele of SKP1 homolog OS=Rattus ... [more]
SUGT1_MOUSE2.214e-1054.00Suppressor of G2 allele of SKP1 homolog OS=Mus mus... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B6EBD4_SOYBN9.510e-2392.73SGT1-1 OS=Glycine max PE=2 SV=1[more]
C6TJ65_SOYBN2.119e-2290.91Putative uncharacterized protein OS=Glycine max PE... [more]
B7FIH5_MEDTR2.119e-2292.73Putative uncharacterized protein OS=Medicago trunc... [more]
B9RCI2_RICCO5.769e-2083.64Chaperone binding protein, putative OS=Ricinus com... [more]
C5XEC3_SORBI1.679e-1980.00Putative uncharacterized protein Sb03g028430 OS=So... [more]
Q9SE32_ORYSA2.192e-1980.00Sgt1 OS=Oryza sativa GN=Sgt1 PE=2 SV=1[more]
Q0JL44_ORYSJ2.192e-1980.00Os01g0624500 protein OS=Oryza sativa subsp. japoni... [more]
B9RIR3_RICCO2.192e-1980.00Chaperone binding protein, putative OS=Ricinus com... [more]
B8ABY6_ORYSI2.192e-1980.00Putative uncharacterized protein OS=Oryza sativa s... [more]
A6N0C5_ORYSI2.192e-1980.00Suppressor of g2 allele of skp1 (Fragment) OS=Oryz... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 4
Match NameE-valueIdentityDescription
AT4G11260.15.412e-2176.36| Symbols: ATSGT1B, ETA3, RPR1, EDM1, SGT1B | phos... [more]
AT4G23570.32.686e-2080.39| Symbols: SGT1A | phosphatase-related | chr4:1230... [more]
AT4G23570.22.686e-2080.39| Symbols: SGT1A | phosphatase-related | chr4:1230... [more]
AT4G23570.12.686e-2080.39| Symbols: SGT1A | phosphatase-related | chr4:1230... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007699SGSPFAMPF05002SGScoord: 6..55
score: 5.9
IPR007699SGSPROFILEPS51048SGScoord: 1..57
score: 25
NoneNo IPR availablePANTHERPTHR22904TPR REPEAT CONTAINING PROTEINcoord: 6..53
score: 1.1
NoneNo IPR availablePANTHERPTHR22904:SF10SUPPRESSOR OF G2 ALLELE OF SKP1 (SGT1)coord: 6..53
score: 1.1

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO063294 ID=HO063294|Name=HO063294|organism=Cicer arietinum|type=EST|length=302bp
GGCGGCCGCGGGAATTCGATTAGCGTGGTCGCGGCCGAGGTACCTAATGA
CAATTTTGGAGGGGATTGGGAAGGAGCAGACAAATGGCTATGAAATAACA
GAAGTTAAATTCATCTTAAAACTGAATCAATACTCCCATTTCTTCACCTC
CATGCCTTCTGGAGGACTGCCTTCCACCTTCTTTGATCCCACTTCTTTCC
AATCAGTTGATAGCACTGTTCCATTTGACTCCAGAAATGACTTGCTCATC
GCTCTCCTCATGTCCTCATCTGCATTTTGGTAGATACCCGCGTACCTGCC
CG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR007699SGS_dom