HO062742
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO062742 vs. TrEMBL
Match: B9RI12_RICCO (Indole-3-acetic acid-induced protein ARG7, putative OS=Ricinus communis GN=RCOM_1575070 PE=4 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 2.268e-7 Identity = 25/40 (62.50%), Postives = 33/40 (82.50%), Query Frame = -3 Query: 167 RE*GYEQKGVLRLPCNVCVFERVLEALKLGQNPRHIIELL 286 +E GY+QKGVL +PC+V VFERV+EAL+LG + R + ELL Sbjct: 92 QEYGYDQKGVLMIPCHVLVFERVMEALRLGLDSRDLDELL 131 HSP 2 Score: 25.0238 bits (53), Expect = 2.268e-7 Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = -2 Query: 276 ELLNHPILGKLLNQSGPGIG 335 ELLNHPI LLN+S G Sbjct: 76 ELLNHPIFIGLLNKSAQEYG 95
BLAST of HO062742 vs. TAIR peptide
Match: AT1G56150.1 (| Symbols: | SAUR-like auxin-responsive protein family | chr1:21017432-21017764 FORWARD LENGTH=110) HSP 1 Score: 49.2914 bits (116), Expect = 2.824e-8 Identity = 21/30 (70.00%), Postives = 28/30 (93.33%), Query Frame = -3 Query: 197 RE*GYEQKGVLRLPCNVCVFERVLEALKLG 286 +E GYEQ+GVLR+PC+V VFER+LE+L+LG Sbjct: 75 QEYGYEQQGVLRIPCHVLVFERILESLRLG 104 HSP 2 Score: 24.6386 bits (52), Expect = 2.824e-8 Identity = 11/20 (55.00%), Postives = 12/20 (60.00%), Query Frame = -2 Query: 276 ELLNHPILGKLLNQSGPGIG 335 ELLNHP+ LL QS G Sbjct: 59 ELLNHPVFVALLKQSAQEYG 78
BLAST of HO062742 vs. TAIR peptide
Match: AT3G12830.1 (| Symbols: | SAUR-like auxin-responsive protein family | chr3:4079117-4079515 REVERSE LENGTH=132) HSP 1 Score: 48.521 bits (114), Expect = 4.650e-8 Identity = 20/30 (66.67%), Postives = 28/30 (93.33%), Query Frame = -3 Query: 197 RE*GYEQKGVLRLPCNVCVFERVLEALKLG 286 +E GYEQKGVL++PC+V VFER++E+L+LG Sbjct: 87 QEYGYEQKGVLQIPCHVLVFERIMESLRLG 116 HSP 2 Score: 24.6386 bits (52), Expect = 4.650e-8 Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = -2 Query: 276 ELLNHPILGKLLNQSGPGIG 335 ELLNHP+ LLN+S G Sbjct: 71 ELLNHPVFIGLLNRSAQEYG 90
BLAST of HO062742 vs. TAIR peptide
Match: AT1G16510.1 (| Symbols: | SAUR-like auxin-responsive protein family | chr1:5644784-5645227 REVERSE LENGTH=147) HSP 1 Score: 45.4394 bits (106), Expect = 3.659e-7 Identity = 20/30 (66.67%), Postives = 25/30 (83.33%), Query Frame = -3 Query: 197 RE*GYEQKGVLRLPCNVCVFERVLEALKLG 286 +E GY QKGVL +PC+V VFERV+E L+LG Sbjct: 91 QEYGYAQKGVLHIPCHVIVFERVVETLRLG 120 HSP 2 Score: 24.6386 bits (52), Expect = 3.659e-7 Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = -2 Query: 276 ELLNHPILGKLLNQSGPGIG 335 EL+NHPI LLN+S G Sbjct: 75 ELMNHPIFVGLLNRSAQEYG 94 The following BLAST results are available for this feature:
BLAST of HO062742 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of HO062742 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO062742 ID=HO062742; Name=HO062742; organism=Cicer arietinum; type=EST; length=405bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|