HO065080
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO065080 vs. TrEMBL
Match: C6TIA2_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 1.995e-17 Identity = 47/63 (74.60%), Postives = 51/63 (80.95%), Query Frame = 2 Query: 11 RPGRYMQAKWLGPFERNTSTIPLSMGYSNEKI-ITKPKYKASMLTVDLLEKLPNMHCKAVEVV 196 R RYMQAKWLGP ERNTST LS+GYS + + KP+ KASMLTVDLLEKLPNMHC AVEVV Sbjct: 238 RKHRYMQAKWLGPCERNTSTASLSVGYSERILPMAKPRPKASMLTVDLLEKLPNMHCNAVEVV 300
BLAST of HO065080 vs. TrEMBL
Match: Q2HTT5_MEDTR (Putative uncharacterized protein OS=Medicago truncatula GN=MtrDRAFT_AC149801g3v2 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.623e-12 Identity = 37/63 (58.73%), Postives = 47/63 (74.60%), Query Frame = 2 Query: 11 RPGRYMQAKWLGPFERNTST-IPLSMGYSNEKIITKPKYKASMLTVDLLEKLPNMHCKAVEVV 196 R +YM+AKWLGP ER ST PLS+G +E+IITK K K SMLT++L +KLP +HC AV+ V Sbjct: 257 RRHKYMEAKWLGPCERYPSTKSPLSIGSFSERIITKQKSKVSMLTIELFDKLPTLHCPAVDEV 319
BLAST of HO065080 vs. TrEMBL
Match: B9RBD3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1674520 PE=4 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.623e-12 Identity = 41/63 (65.08%), Postives = 48/63 (76.19%), Query Frame = 2 Query: 11 RPGRYMQAKWLGPFERNTSTIP-LSMGYSNEKIITKPKYKASMLTVDLLEKLPNMHCKAVEVV 196 R RYMQAKWLG ER ++IP SMGYS + ++KPK +SMLTVDLL+ LPNMHC AVEVV Sbjct: 250 RKRRYMQAKWLGTCERTVASIPSFSMGYSGK--VSKPK--SSMLTVDLLDLLPNMHCTAVEVV 308
BLAST of HO065080 vs. TrEMBL
Match: D7T0D9_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_265.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00005210001 PE=4 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 4.761e-11 Identity = 40/62 (64.52%), Postives = 42/62 (67.74%), Query Frame = 2 Query: 11 RPGRYMQAKWLGPFERNTSTIPLSMGYSNEKIITKPKYKASMLTVDLLEKLPNMHCKAVEVV 196 R RYMQAKWL R+TST L G S PK KASMLTVDL+EKLPNMHC AVEVV Sbjct: 218 RKHRYMQAKWLSTCVRSTSTSSLLSGDSGRL----PKPKASMLTVDLMEKLPNMHCTAVEVV 275
BLAST of HO065080 vs. TrEMBL
Match: C6TEE1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.030e-10 Identity = 37/58 (63.79%), Postives = 43/58 (74.14%), Query Frame = 2 Query: 11 RPGRYMQAKWLGPFERNTSTIPLSMGYSNEKIITKPKYKASMLTVDLLEKLPN--MHC 178 R RYMQAKWLGP ERNTST LS+ Y+ E+I+ +P KASMLTVDLLEK +HC Sbjct: 246 RKHRYMQAKWLGPCERNTSTTSLSVRYNFERILPRP--KASMLTVDLLEKPSQYALHC 301
BLAST of HO065080 vs. TrEMBL
Match: B9H2U2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_555791 PE=4 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.772e-8 Identity = 37/63 (58.73%), Postives = 41/63 (65.08%), Query Frame = 2 Query: 11 RPGRYMQAKWLGPF-ERNTSTIPLSMGYSNEKIITKPKYKASMLTVDLLEKLPNMHCKAVEVV 196 R RYMQAKWL ER+TS P SMG S P+ KASMLTVDL E LP++HC AV VV Sbjct: 248 RKQRYMQAKWLRTTCERSTSMPPFSMGSSGRL----PRPKASMLTVDLKEMLPDVHCTAVAVV 306
BLAST of HO065080 vs. TrEMBL
Match: B9RVY5_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1174190 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.434e-8 Identity = 33/63 (52.38%), Postives = 45/63 (71.43%), Query Frame = 2 Query: 11 RPGRYMQAKWLGPFERNTSTI-PLSMGYSNEKIITKPKYKASMLTVDLLEKLPNMHCKAVEVV 196 R +YMQ+KWLG ER TS + PL +G+S+ TKP+ ASMLT D+L+ LP +HC AV+V+ Sbjct: 234 RKHKYMQSKWLGTCERTTSAMDPLPVGFSDRP--TKPR--ASMLTYDMLQNLPVLHCTAVKVL 292
BLAST of HO065080 vs. TrEMBL
Match: B9N3G4_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_743822 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.434e-8 Identity = 36/63 (57.14%), Postives = 41/63 (65.08%), Query Frame = 2 Query: 11 RPGRYMQAKWLGPF-ERNTSTIPLSMGYSNEKIITKPKYKASMLTVDLLEKLPNMHCKAVEVV 196 R RYMQAKWL ER TS PLSMG+S + + KASMLTVDL E LP++HC A VV Sbjct: 248 RKQRYMQAKWLATACERATSMPPLSMGHSGRLL----RPKASMLTVDLKEMLPHVHCTAATVV 306 The following BLAST results are available for this feature:
BLAST of HO065080 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 8
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO065080 ID=HO065080; Name=HO065080; organism=Cicer arietinum; type=EST; length=459bpback to top |