HO067499

EST Overview
NameHO067499
Unique NameHO067499
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length535
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
InterProScan analysis for Cicer arietinum unigene v12010-12-29
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO067499 vs. TrEMBL
Match: B9RIG0_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1578760 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 7.391e-51
Identity = 102/177 (57.63%), Postives = 130/177 (73.45%), Query Frame = 3
Query:    3 GRYSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            G YSEKLLEMKA++L  L +YEEVIQLCD+T  SAEKN+  +  G Q   LD  +L+K   F LWRC ++LK+YF++                +  + + G+K + SLIPLAATV ELL+HK AGNEA+QAG+H+EA+E+YT+ LSCNVESRPFAA+CYCNRAAAYKALG +TDA+A
Sbjct:  947 GPYSEKLLEMKADSLFLLRKYEEVIQLCDQTFDSAEKNSPLLDTGYQSADLDGTQLTKDSSFCLWRCHLILKSYFYLGKLEEAIASLEKQEELI--VKRCGNKKIESLIPLAATVRELLRHKAAGNEAFQAGKHSEAIEYYTAALSCNVESRPFAAICYCNRAAAYKALGLVTDAIA 1121          
BLAST of HO067499 vs. TrEMBL
Match: D7SNG0_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_61.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00031545001 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.884e-46
Identity = 97/175 (55.43%), Postives = 124/175 (70.86%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            +SEKLLEMKAEAL  L +YEEVIQLC++TL SAEKN+  + +   +  LD + LSK   FRLWR  ++ K+YF++                      +G+K L S IPLAATV ELL+HK AGNEA+Q+GRH EAVEHYT+ LSCN+ SRPF A+C+CNR+AA+KALGQI+DA+A
Sbjct:  617 FSEKLLEMKAEALFMLRKYEEVIQLCEQTLGSAEKNSPTLGSDGHLANLDGSGLSKDSSFRLWRVRLIFKSYFYLGRLEDALTLLEKQKEF-----GNGNKTLESSIPLAATVRELLRHKNAGNEAFQSGRHAEAVEHYTAALSCNIVSRPFTAICFCNRSAAHKALGQISDAIA 786          
BLAST of HO067499 vs. TrEMBL
Match: D7M521_ARALY (DNAJ heat shock N-terminal domain-containing protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_488090 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.720e-45
Identity = 94/175 (53.71%), Postives = 121/175 (69.14%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            YSEKLL MK EAL+ L +YE  I+LC++T+  A KN+ P          D+ +  K   FR+W+C +MLK+YFH+                +SA  + G+K L S IPLAAT+ ELL+ K+AGNEA+Q+GRHTEAVEHYT+ L+CNVESRPF AVC+CNRAAAYKALGQ +DA+A
Sbjct:  771 YSEKLLTMKGEALLMLEKYEAAIKLCEQTVDLAGKNSLP----------DSHDTPKDTNFRIWQCHVMLKSYFHMGKLEEAIASLEKQEQLLSATKRDGNKTLESSIPLAATIRELLRLKSAGNEAFQSGRHTEAVEHYTAALACNVESRPFTAVCFCNRAAAYKALGQYSDAIA 935          
BLAST of HO067499 vs. TrEMBL
Match: D7TSA9_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_252.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00005044001 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 6.934e-41
Identity = 93/175 (53.14%), Postives = 116/175 (66.29%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            YSEKLLEMKAEAL  L +YEEVIQLC++TL  AEKN        Q+   +  +  +  + RLWR  ++ K+YFH+                     +  S+ + S IPLAAT+ ELLQ K AGNEA+Q+GR+TEAVEHYTS LS NVESRPFAA+C CNRAAA++ALGQI DA+A
Sbjct: 1175 YSEKLLEMKAEALFMLRKYEEVIQLCEQTLGFAEKNFALAGNDEQLENTNGFKCKRRSFVRLWRSRLISKSYFHMGRLEVALDLLEK--------QEYASETVESSIPLAATIRELLQIKRAGNEAFQSGRYTEAVEHYTSALSINVESRPFAAICLCNRAAAHQALGQIADAIA 1341          
BLAST of HO067499 vs. TrEMBL
Match: Q94CJ9_ARATH (Putative uncharacterized protein At5g12430 OS=Arabidopsis thaliana GN=At5g12430 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.708e-39
Identity = 91/197 (46.19%), Postives = 119/197 (60.41%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKT----------------------AGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            YSEKLL MK EAL+ L +Y+  I+LC++T+  A KN+ P          D+ +  K   FR+W+C +MLK+ F++                +SA  + G+K L S IPLAAT+ ELL+ K                       AGNEA+Q+GRHTEAVEHYT+ L+CNVESRPF AVC+CNRAAAYKALGQ +DA+A
Sbjct:  774 YSEKLLTMKGEALLMLEKYDAAIKLCEQTVDLAGKNSPP----------DSHDTPKDINFRIWQCHLMLKSSFYMGKLEEAIASLEKQEQLLSATKREGNKTLESSIPLAATIRELLRLKVLPSSSMSIALNLHLLFRIQLPAAGNEAFQSGRHTEAVEHYTAALACNVESRPFTAVCFCNRAAAYKALGQFSDAIA 960          
BLAST of HO067499 vs. TrEMBL
Match: B9T352_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0142870 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.888e-38
Identity = 81/175 (46.29%), Postives = 117/175 (66.86%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            YSE+LLEMKAE +  L RYEE+IQLC++TL +AEKN        Q+   D ++     + RLWR  ++ K+YF++                 S  +K+ +K+L S + LA T+  L+ +K+AGNEA ++GR+TEA+EHYT+ +S N+ESRPFAA+C+CNRAAA++AL QI DA+A
Sbjct: 1091 YSERLLEMKAEFMFMLQRYEEMIQLCEQTLHAAEKNFASSGIEDQLVVRDGSQNECHSFARLWRWRLISKSYFYLGRLEVALDFLEKLERIGSTSDKNANKILESSVSLAVTIRALVNYKSAGNEAVRSGRYTEALEHYTAAISSNIESRPFAAICFCNRAAAHQALSQIADAIA 1265          
BLAST of HO067499 vs. TrEMBL
Match: B9IHX5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_576240 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.146e-35
Identity = 80/177 (45.20%), Postives = 114/177 (64.41%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXX--VSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            YSE+LLEMKA+ L  L +Y+EVIQ+C++TL +AEKN   I    Q   +  +E     + R+WR  ++ K+YF++                  +S      SK+L S + LA T+ +LL+HK+AGNEA Q+ R+TEAVEHYT  L  ++ESRPFAA+C+ NRAAA++ALGQI DA++
Sbjct: 1060 YSERLLEMKAKFLFMLRKYKEVIQMCEQTLGAAEKNFVSIGVDGQFVDIGCSESENCSFARVWRWHLISKSYFYLGKLEVALDLLQKLEQMGSISCKKADASKILESSVTLAVTIRDLLRHKSAGNEAVQSARYTEAVEHYTGALLNSIESRPFAAICFGNRAAAHQALGQIADAIS 1236          
BLAST of HO067499 vs. TrEMBL
Match: B9H9J4_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_560471 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.954e-35
Identity = 82/177 (46.33%), Postives = 116/177 (65.54%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINK--SGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            YSE+LLEMKAE L  L +Y+EVIQLC++TL +AEK    + A  Q   +  +E     + R+WR  ++ K+ F++                 S   K  + +K+L S + LA TV +LL+HK+AGNEA ++GR+ EAVEHYT+ LS N+ESRPF+A+C+ NRAAA++ALGQI DA+A
Sbjct: 1044 YSERLLEMKAEFLFMLQKYKEVIQLCEQTLCAAEKYFASVGADGQFVDIGCSESENCSFARVWRWHLISKSNFYLGKLEVALDLLEKLEQMRSISYKYANANKILESSVTLAVTVRDLLRHKSAGNEAVRSGRYAEAVEHYTAALSNNIESRPFSAICFGNRAAAHQALGQIADAIA 1220          
BLAST of HO067499 vs. TrEMBL
Match: A5ARG1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_043011 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.286e-34
Identity = 82/175 (46.86%), Postives = 104/175 (59.43%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            YSEKLLEMKAEAL  L +YEEVIQLC++TL  AEKN        Q+   +  +  +  + RLWR  ++ K+YFH+                                       +LL+ + AGNEA+Q+GR+TEAVEHYTS LS NVESRPFAA+C CNRAAA++ALGQI DA+A
Sbjct: 1233 YSEKLLEMKAEALXMLRKYEEVIQLCEQTLGFAEKNFALAGNDEQLENTNGFKCKRRSFVRLWRSHLISKSYFHMGRLE--------------------------------VALDLLEKQEAGNEAFQSGRYTEAVEHYTSALSINVESRPFAAICLCNRAAAHQALGQIADAIA 1375          
BLAST of HO067499 vs. TrEMBL
Match: B8AXP2_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_19729 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 5.884e-32
Identity = 78/175 (44.57%), Postives = 105/175 (60.00%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            +S+KL+EMKAEAL+ L +YEEVIQLC ET+  AEKN+             +A  +  +  RLWR  ++ K YF                   +     G         L+ T+ ELL HK AGNEA+QA R++EAVE Y++ L+ N +SRPF+AVC+CNRAAAY+ALGQ+TDA+A
Sbjct:  451 HSDKLMEMKAEALLTLRKYEEVIQLCQETVVLAEKNS-------------SASETTEWSGRLWRTYLICKTYFLSGKLEDALELLNKHQQVTNVKESEGRTSQECFSSLSTTIRELLSHKAAGNEAFQARRYSEAVEQYSAALARNSDSRPFSAVCFCNRAAAYQALGQVTDAIA 612          
BLAST of HO067499 vs. TAIR peptide
Match: AT5G12430.1 (| Symbols: TPR16 | Heat shock protein DnaJ with tetratricopeptide repeat | chr5:4028475-4034086 REVERSE LENGTH=1165)

HSP 1 Score: 178.333 bits (451), Expect = 2.132e-45
Identity = 91/175 (52.00%), Postives = 119/175 (68.00%), Query Frame = 3
Query:    9 YSEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            YSEKLL MK EAL+ L +Y+  I+LC++T+  A KN+ P          D+ +  K   FR+W+C +MLK+ F++                +SA  + G+K L S IPLAAT+ ELL+ K AGNEA+Q+GRHTEAVEHYT+ L+CNVESRPF AVC+CNRAAAYKALGQ +DA+A
Sbjct:  774 YSEKLLTMKGEALLMLEKYDAAIKLCEQTVDLAGKNSPP----------DSHDTPKDINFRIWQCHLMLKSSFYMGKLEEAIASLEKQEQLLSATKREGNKTLESSIPLAATIRELLRLKAAGNEAFQSGRHTEAVEHYTAALACNVESRPFTAVCFCNRAAAYKALGQFSDAIA 938          
BLAST of HO067499 vs. TAIR peptide
Match: AT2G41520.1 (| Symbols: TPR15 | Heat shock protein DnaJ with tetratricopeptide repeat | chr2:17317662-17322705 FORWARD LENGTH=1108)

HSP 1 Score: 131.339 bits (329), Expect = 2.988e-31
Identity = 75/174 (43.10%), Postives = 107/174 (61.49%), Query Frame = 3
Query:   12 SEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            S+KLL+MKAEAL  + RY+EVI+LC+ TL +AE+N   ++AG   T   N   S      +WR + + K++F++                    N++  +   S   L AT+ ELL++K AGNEA +  ++ EAVE YT+ LS NV+SRPFAA+C+CNRAAA +AL QI DA+A
Sbjct:  720 SDKLLQMKAEALFMIRRYKEVIELCENTLQTAERNF--VSAGIGGTTNVNGLGSTYHSLIVWRWNKISKSHFYLGNLEKALDILEKLQQVEYTCNENQEECRESPASLVATISELLRYKNAGNEAVRDRKYMEAVEQYTAALSRNVDSRPFAAICFCNRAAANQALVQIADAIA 891          
BLAST of HO067499 vs. TAIR peptide
Match: AT2G41520.2 (| Symbols: TPR15 | Heat shock protein DnaJ with tetratricopeptide repeat | chr2:17317662-17322705 FORWARD LENGTH=1077)

HSP 1 Score: 78.9518 bits (193), Expect = 1.760e-15
Identity = 56/174 (32.18%), Postives = 83/174 (47.70%), Query Frame = 3
Query:   12 SEKLLEMKAEALIRLCRYEEVIQLCDETLSSAEKNACPIAAGCQVTYLDNAELSKVFYFRLWRCSMMLKAYFHIXXXXXXXXXXXXXXXXVSAINKSGSKVLASLIPLAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRPFAAVCYCNRAAAYKALGQITDAVA 533
            S+KLL+MKAEAL  + RY+EVI+LC+ TL +AE+N   ++AG   T   N   S      +WR + + K++F++                    N++  +   S   L AT+ ELL++K                                AA+C+CNRAAA +AL QI DA+A
Sbjct:  720 SDKLLQMKAEALFMIRRYKEVIELCENTLQTAERNF--VSAGIGGTTNVNGLGSTYHSLIVWRWNKISKSHFYLGNLEKALDILEKLQQVEYTCNENQEECRESPASLVATISELLRYKN-------------------------------AAICFCNRAAANQALVQIADAIA 860          
BLAST of HO067499 vs. TAIR peptide
Match: AT3G62570.1 (| Symbols: | Tetratricopeptide repeat (TPR)-like superfamily protein | chr3:23142616-23144563 FORWARD LENGTH=552)

HSP 1 Score: 50.8322 bits (120), Expect = 5.133e-7
Identity = 26/69 (37.68%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  333 LAATVCELLQHKTAGNEAYQAGRHTEAVEHYTSVLSCNVESRP--FAAVCYCNRAAAYKALGQITDAVA 533
            L A    LL+ ++AG  A+ AG   +++ H++ +L       P  F A CY +RAAAYK+ G+I +A+A
Sbjct:  233 LLAHTKNLLRRRSAGFAAFDAGLFADSIRHFSKILDGRRRPAPQGFLADCYMHRAAAYKSAGKIAEAIA 301          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9RIG0_RICCO7.391e-5157.63Putative uncharacterized protein OS=Ricinus commun... [more]
D7SNG0_VITVI1.884e-4655.43Whole genome shotgun sequence of line PN40024, sca... [more]
D7M521_ARALY2.720e-4553.71DNAJ heat shock N-terminal domain-containing prote... [more]
D7TSA9_VITVI6.934e-4153.14Whole genome shotgun sequence of line PN40024, sca... [more]
Q94CJ9_ARATH1.708e-3946.19Putative uncharacterized protein At5g12430 OS=Arab... [more]
B9T352_RICCO1.888e-3846.29Putative uncharacterized protein OS=Ricinus commun... [more]
B9IHX5_POPTR1.146e-3545.20Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9H9J4_POPTR1.954e-3546.33Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A5ARG1_VITVI6.286e-3446.86Putative uncharacterized protein OS=Vitis vinifera... [more]
B8AXP2_ORYSI5.884e-3244.57Putative uncharacterized protein OS=Oryza sativa s... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 4
Match NameE-valueIdentityDescription
AT5G12430.12.132e-4552.00| Symbols: TPR16 | Heat shock protein DnaJ with te... [more]
AT2G41520.12.988e-3143.10| Symbols: TPR15 | Heat shock protein DnaJ with te... [more]
AT2G41520.21.760e-1532.18| Symbols: TPR15 | Heat shock protein DnaJ with te... [more]
AT3G62570.15.133e-737.68| Symbols: | Tetratricopeptide repeat (TPR)-like ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023114Elongated TPR repeat-containing domainGENE3D1.10.150.160no descriptioncoord: 120..176
score: 5.4
NoneNo IPR availablePANTHERPTHR22904TPR REPEAT CONTAINING PROTEINcoord: 3..172
score: 6.8
NoneNo IPR availablePANTHERPTHR22904:SF36HSC70-INTERACTING PROTEIN-RELATEDcoord: 3..172
score: 6.8
NoneNo IPR availableSEGsegsegcoord: 78..93
score
NoneNo IPR availableSUPERFAMILY48452TPR-likecoord: 121..177
score: 1.6
NoneNo IPR availableSEGsegsegcoord: 37..52
score

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO067499 ID=HO067499|Name=HO067499|organism=Cicer arietinum|type=EST|length=535bp
CGGGCAGGTACTCTGAAAAATTGCTTGAAATGAAAGCAGAGGCTCTTATA
AGGCTGTGTAGATACGAGGAGGTGATTCAGCTGTGTGACGAGACCCTTAG
TTCTGCTGAGAAGAATGCTTGTCCAATAGCTGCTGGTTGCCAAGTCACAT
ATCTGGATAATGCAGAACTCTCAAAAGTCTTCTACTTCAGACTATGGAGA
TGTTCAATGATGCTTAAAGCCTATTTTCACATAGGAAAGCTTGAAGAAGG
TCTTTCTTTGCTGGAACAACAAGAGGAAAAGGTGTCTGCCATTAACAAGA
GTGGAAGCAAGGTTTTGGCTTCACTTATACCACTAGCTGCCACTGTATGC
GAGCTCTTGCAGCATAAGACTGCAGGGAATGAAGCATATCAGGCTGGCAG
ACACACAGAAGCTGTTGAACACTATACATCTGTTTTATCTTGTAATGTGG
AGTCTCGTCCATTTGCAGCTGTATGCTATTGTAATCGTGCCGCTGCATAT
AAAGCATTAGGTCAAATAACCGATGCTGTCGCACA
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR023114Elongated_TPR_rpt_dom