GR395019
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR395019 vs. TrEMBL
Match: Q8LCM7_ARATH (Putative uncharacterized protein OS=Arabidopsis thaliana PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.461e-7 Identity = 25/41 (60.98%), Postives = 33/41 (80.49%), Query Frame = -3 Query: 126 GGFEXQVKYRAKEVKSFFKKGVRIVGNSWKKGWSKVKHIKK 248 G FE QVK RA E+K FKKG+++VG S KKGWSKVK++++ Sbjct: 2 GAFEDQVKMRALELKHLFKKGIKVVGKSCKKGWSKVKNLRR 42
BLAST of GR395019 vs. TrEMBL
Match: D7L4J5_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_900440 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.461e-7 Identity = 26/47 (55.32%), Postives = 36/47 (76.60%), Query Frame = -3 Query: 108 GGFEXQVKYRAKEVKSFFKKGVRIVGNSWKKGWSKVKHIKK*SINIS 248 G FE QVK RA E+K FKKG+++VG S KKGWSKVK++++ ++S Sbjct: 2 GAFEDQVKMRALELKHLFKKGIKVVGKSCKKGWSKVKNLRQAGDDVS 48
BLAST of GR395019 vs. TrEMBL
Match: A9PDN1_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.160e-7 Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = -3 Query: 126 GGFEXQVKYRAKEVKSFFKKGVRIVGNSWKKGWSKVKHIKK 248 G FE +VK RAKE+ FKKGV+IVG S KKGW KVK++KK Sbjct: 2 GDFENKVKVRAKELTVLFKKGVKIVGESCKKGWIKVKNMKK 42 The following BLAST results are available for this feature:
BLAST of GR395019 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR395019 ID=GR395019; Name=GR395019; organism=Cicer arietinum; type=EST; length=370bpback to top |