HO664218

EST Overview
NameHO664218
Unique NameHO664218
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length517
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
InterProScan analysis for Cicer arietinum unigene v12010-12-29
Libraries
Library NameType
LIBEST_026619 TDZ treated Chickpea SSH librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of HO664218 vs. TrEMBL
Match: C6TE10_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.075e-16
Identity = 40/46 (86.96%), Postives = 45/46 (97.83%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            VQQCFEELVLK+LDTPSL+AEGSKGVKKNIFK++PPQSDA+TS CC
Sbjct:  164 VQQCFEELVLKILDTPSLIAEGSKGVKKNIFKERPPQSDASTSSCC 209          
BLAST of HO664218 vs. TrEMBL
Match: C6T2M4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.404e-16
Identity = 40/46 (86.96%), Postives = 44/46 (95.65%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            VQQCFEELVLK+LDTPSL+AEGSKGVKKNIFKD+PPQSDA+ S CC
Sbjct:  164 VQQCFEELVLKILDTPSLIAEGSKGVKKNIFKDRPPQSDASASSCC 209          
BLAST of HO664218 vs. TrEMBL
Match: Q40207_LOTJA (RAB1Y (Fragment) OS=Lotus japonicus GN=rab1Y PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.834e-16
Identity = 41/46 (89.13%), Postives = 44/46 (95.65%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            VQQCFEELVLK+LDTPSLLAEGSKGVKKNIFKDK PQ+DA+TS CC
Sbjct:  162 VQQCFEELVLKILDTPSLLAEGSKGVKKNIFKDKQPQADASTSSCC 207          
BLAST of HO664218 vs. TrEMBL
Match: A5ATB8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_027716 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.189e-15
Identity = 38/46 (82.61%), Postives = 44/46 (95.65%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            V+QCFEELVLK+L+TPSLLAEGS GV+KNIFK KPP+SDA+TSGCC
Sbjct:  152 VEQCFEELVLKILETPSLLAEGSSGVRKNIFKQKPPESDASTSGCC 197          
BLAST of HO664218 vs. TrEMBL
Match: B9HES5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_832239 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.458e-15
Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            VQQCFEELVLKVLDTPSLLAEGSKGVKKNIF +K PQ DA+TS CC
Sbjct:  164 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFNEKRPQPDASTSSCC 209          
BLAST of HO664218 vs. TrEMBL
Match: B9H489_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_818249 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.517e-15
Identity = 39/46 (84.78%), Postives = 42/46 (91.30%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            VQQCFEELVLK+LDTPSLLAEGSKGVKKNIF +K PQ DA+TS CC
Sbjct:  164 VQQCFEELVLKILDTPSLLAEGSKGVKKNIFSEKRPQPDASTSSCC 209          
BLAST of HO664218 vs. TrEMBL
Match: C6SWE3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.899e-15
Identity = 37/46 (80.43%), Postives = 43/46 (93.48%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            V QCF+ELV+K+L+TPSLLAEGS GVKKNIFK KPPQSDA++SGCC
Sbjct:  168 VAQCFDELVMKILETPSLLAEGSSGVKKNIFKQKPPQSDASSSGCC 213          
BLAST of HO664218 vs. TrEMBL
Match: C6TJB7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.824e-14
Identity = 36/46 (78.26%), Postives = 42/46 (91.30%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            V QCF+ELV+K+L+TPSLLAEGS GVKKNIFK KPP SDA++SGCC
Sbjct:  167 VTQCFDELVMKILETPSLLAEGSSGVKKNIFKQKPPLSDASSSGCC 212          
BLAST of HO664218 vs. TrEMBL
Match: B7FMN8_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.824e-14
Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            VQ CFEELVLK+LDTPSLLAE SKG KKNIFKDK PQSDA+TSGCC
Sbjct:  163 VQHCFEELVLKILDTPSLLAESSKGNKKNIFKDK-PQSDASTSGCC 207          
BLAST of HO664218 vs. TrEMBL
Match: C5YB63_SORBI (Putative uncharacterized protein Sb06g034200 OS=Sorghum bicolor GN=Sb06g034200 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.112e-13
Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            V+QCFEELVLK+LDTPSLLA+ S G KKNIFK KPP++DAA S CC
Sbjct:  170 VEQCFEELVLKILDTPSLLADASSGAKKNIFKQKPPEADAAASSCC 215          
BLAST of HO664218 vs. TAIR peptide
Match: AT1G43890.3 (| Symbols: ATRAB18, ATRABC1, RAB18-1, RABC1, ATRAB-C1, RAB18 | RAB GTPASE HOMOLOG B18 | chr1:16646934-16648395 FORWARD LENGTH=212)

HSP 1 Score: 65.4698 bits (158), Expect = 1.898e-11
Identity = 30/46 (65.22%), Postives = 36/46 (78.26%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            V+QCFEELVLK+L+TPSL AEGS G KKNIFK  P Q+ + +S  C
Sbjct:  164 VEQCFEELVLKILETPSLTAEGSSGGKKNIFKQNPAQTTSTSSSYC 209          
BLAST of HO664218 vs. TAIR peptide
Match: AT1G43890.2 (| Symbols: ATRAB18, ATRABC1, RAB18-1, RABC1, ATRAB-C1, RAB18 | RAB GTPASE HOMOLOG B18 | chr1:16646934-16648395 FORWARD LENGTH=212)

HSP 1 Score: 65.4698 bits (158), Expect = 1.898e-11
Identity = 30/46 (65.22%), Postives = 36/46 (78.26%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            V+QCFEELVLK+L+TPSL AEGS G KKNIFK  P Q+ + +S  C
Sbjct:  164 VEQCFEELVLKILETPSLTAEGSSGGKKNIFKQNPAQTTSTSSSYC 209          
BLAST of HO664218 vs. TAIR peptide
Match: AT1G43890.1 (| Symbols: ATRAB18, ATRABC1, RAB18-1, RABC1, ATRAB-C1, RAB18 | RAB GTPASE HOMOLOG B18 | chr1:16646934-16648395 FORWARD LENGTH=212)

HSP 1 Score: 65.4698 bits (158), Expect = 1.898e-11
Identity = 30/46 (65.22%), Postives = 36/46 (78.26%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            V+QCFEELVLK+L+TPSL AEGS G KKNIFK  P Q+ + +S  C
Sbjct:  164 VEQCFEELVLKILETPSLTAEGSSGGKKNIFKQNPAQTTSTSSSYC 209          
BLAST of HO664218 vs. TAIR peptide
Match: AT5G03530.1 (| Symbols: ATRAB ALPHA, ATRAB, ATRAB18B, ATRABC2A, RABC2A | RAB GTPase homolog C2A | chr5:885741-887061 REVERSE LENGTH=210)

HSP 1 Score: 62.3882 bits (150), Expect = 1.607e-10
Identity = 27/46 (58.70%), Postives = 32/46 (69.57%), Query Frame = 3
Query:   21 VQQCFEELVLKVLDTPSLLAEGSKGVKKNIFKDKPPQSDAATSGCC 158
            V+QCFEEL LK+++ PSLL EGS  VK+NI K KP       SGCC
Sbjct:  164 VEQCFEELALKIMEVPSLLEEGSSAVKRNILKQKPEHQTNTQSGCC 209          
The following BLAST results are available for this feature:
Homology Analysis: Cicer arietinum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6TE10_SOYBN1.075e-1686.96Putative uncharacterized protein OS=Glycine max PE... [more]
C6T2M4_SOYBN1.404e-1686.96Putative uncharacterized protein OS=Glycine max PE... [more]
Q40207_LOTJA1.834e-1689.13RAB1Y (Fragment) OS=Lotus japonicus GN=rab1Y PE=2 ... [more]
A5ATB8_VITVI1.189e-1582.61Putative uncharacterized protein OS=Vitis vinifera... [more]
B9HES5_POPTR3.458e-1586.96Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9H489_POPTR4.517e-1584.78Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
C6SWE3_SOYBN5.899e-1580.43Putative uncharacterized protein OS=Glycine max PE... [more]
C6TJB7_SOYBN3.824e-1478.26Putative uncharacterized protein OS=Glycine max PE... [more]
B7FMN8_MEDTR3.824e-1486.96Putative uncharacterized protein OS=Medicago trunc... [more]
C5YB63_SORBI1.112e-1376.09Putative uncharacterized protein Sb06g034200 OS=So... [more]
back to top
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 4
Match NameE-valueIdentityDescription
AT1G43890.31.898e-1165.22| Symbols: ATRAB18, ATRABC1, RAB18-1, RABC1, ATRAB... [more]
AT1G43890.21.898e-1165.22| Symbols: ATRAB18, ATRABC1, RAB18-1, RABC1, ATRAB... [more]
AT1G43890.11.898e-1165.22| Symbols: ATRAB18, ATRABC1, RAB18-1, RABC1, ATRAB... [more]
AT5G03530.11.607e-1058.70| Symbols: ATRAB ALPHA, ATRAB, ATRAB18B, ATRABC2A,... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 6..25
score
NoneNo IPR availableSEGsegsegcoord: 23..44
score

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>HO664218 ID=HO664218|Name=HO664218|organism=Cicer arietinum|type=EST|length=517bp
TCGAGCGGCCGCCCGGGCAGGTACAACAATGCTTTGAAGAGCTTGTTTTG
AAGGTTTTGGACACACCTAGCCTCTTAGCCGAGGGATCTAAAGGGGTCAA
AAAGAACATTTTTAAGGACAAGCCACCCCAGTCTGATGCAGCCACAAGTG
GTTGTTGCTAAGAAAAGGCTATTTCACTCAAAGTAAAAAATCACTGCCTA
TTGAAGATCTCAAAAAAAAGGGCGTTGAATCCGTTTTCAGAATCAGAGTT
CTAAAACACGCTTATTGGTGTTTATTTAGCACCAGCTGAAGTCTTCTAAA
AAAGAATCCATGCTCCTGGTTTGTCTGGAATATTTGTAATATAATGATTA
TGGTTTTCTCTTCTTTTTCCTTATTTGGATTTTATTATTATTATTATTTG
CATTTAATTTCATATATTTTGACGTGCAAGAATCGTGGATATATCATGTT
ATGAAAACCAATTCTAATTGTAAACAATGCCTGGACAACAATGTCATGTA
ACTTTTTTAAACAAAAA
back to top