GR420694
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR420694 vs. TrEMBL
Match: B7FKH8_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.388e-10 Identity = 35/50 (70.00%), Postives = 37/50 (74.00%), Query Frame = -1 Query: 288 VPRFPRVLVELILGHLRYLLTPQDVPPNSPPDNVFRPDWPTEVSLGAAPR 437 VP VLVELILGHLRYLLT PNSPPDNVFRPD PT+V LG+ R Sbjct: 67 VPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPTKVGLGSKKR 116
BLAST of GR420694 vs. TrEMBL
Match: Q0WLP3_ARATH (Putative uncharacterized protein OS=Arabidopsis thaliana PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.534e-9 Identity = 34/50 (68.00%), Postives = 34/50 (68.00%), Query Frame = -1 Query: 288 VPRFPRVLVELILGHLRYLLTPQDVPPNSPPDNVFRPDWPTEVSLGAAPR 437 VP VLVELILGHLRYLLT PNSPPDNV RPD P E SLG R Sbjct: 67 VPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVLRPDRPAEASLGTKNR 116
BLAST of GR420694 vs. TrEMBL
Match: B2KZF9_PICAB (Senescence-associated protein OS=Picea abies GN=SAP1 PE=2 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 1.573e-9 Identity = 34/50 (68.00%), Postives = 34/50 (68.00%), Query Frame = -1 Query: 288 VPRFPRVLVELILGHLRYLLTPQDVPPNSPPDNVFRPDWPTEVSLGAAPR 437 VP VLVELILGHLRYLLT PNSPPDNVFRPD P E L A R Sbjct: 67 VPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPVETCLKAKNR 116 HSP 2 Score: 21.1718 bits (43), Expect = 1.573e-9 Identity = 11/23 (47.83%), Postives = 12/23 (52.17%), Query Frame = -3 Query: 175 KFHFRVVVLFLSSHSSPLILHQS 243 K +VVV L PLILH S Sbjct: 128 KITLKVVVFHLRRKRLPLILHLS 150
BLAST of GR420694 vs. TrEMBL
Match: B2BAK4_LILLO (Cytochrome P450-like TBP protein (Fragment) OS=Lilium longiflorum PE=2 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.464e-9 Identity = 33/50 (66.00%), Postives = 34/50 (68.00%), Query Frame = -1 Query: 288 VPRFPRVLVELILGHLRYLLTPQDVPPNSPPDNVFRPDWPTEVSLGAAPR 437 VP VLVELILGHLRYLLT PNSPPDNVFRPD P LG+ R Sbjct: 13 VPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPAGAGLGSKRR 62
BLAST of GR420694 vs. TrEMBL
Match: C4J720_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.779e-8 Identity = 31/42 (73.81%), Postives = 31/42 (73.81%), Query Frame = -1 Query: 312 VPRFPRVLVELILGHLRYLLTPQDVPPNSPPDNVFRPDWPTE 437 VP VLVELILGHLRYLLT PNSPPDNVFRPD P E Sbjct: 67 VPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRPDRPGE 108 The following BLAST results are available for this feature:
BLAST of GR420694 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR420694 ID=GR420694; Name=GR420694; organism=Cicer arietinum; type=EST; length=437bpback to top |