FL512438
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FL512438 vs. TrEMBL
Match: D5LQ68_MEDTR (Nitrate transporter NRT1.1 OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 3.157e-15 Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 64 GVLNFVLSLVLAMRPEYKAQHNNIETNDSIXKXLVIAN 177 GVLNFVL LVL+MR +YK QHNNIE+ND++ K LV+ N Sbjct: 539 GVLNFVLFLVLSMRHQYKVQHNNIESNDNVEKELVLVN 576 HSP 2 Score: 47.7506 bits (112), Expect = 3.157e-15 Identity = 22/30 (73.33%), Postives = 26/30 (86.67%), Query Frame = 2 Query: 2 WLKSNLNKGKLDYFYWLLAVLEC*ILYFLL 91 WLKSNL+KGKLDYFYWLLA+L +L F+L Sbjct: 518 WLKSNLDKGKLDYFYWLLAILG--VLNFVL 545
BLAST of FL512438 vs. TrEMBL
Match: B7FLX1_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 3.224e-15 Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 64 GVLNFVLSLVLAMRPEYKAQHNNIETNDSIXKXLVIAN 177 GVLNFVL LVL+MR +YK QHNNIE+ND++ K LV+ N Sbjct: 216 GVLNFVLFLVLSMRHQYKVQHNNIESNDNVEKELVLVN 253 HSP 2 Score: 47.7506 bits (112), Expect = 3.224e-15 Identity = 22/30 (73.33%), Postives = 26/30 (86.67%), Query Frame = 2 Query: 2 WLKSNLNKGKLDYFYWLLAVLEC*ILYFLL 91 WLKSNL+KGKLDYFYWLLA+L +L F+L Sbjct: 195 WLKSNLDKGKLDYFYWLLAILG--VLNFVL 222
BLAST of FL512438 vs. TrEMBL
Match: C6T7P6_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 47.3654 bits (111), Expect = 1.912e-10 Identity = 19/21 (90.48%), Postives = 21/21 (100.00%), Query Frame = 2 Query: 2 WLKSNLNKGKLDYFYWLLAVL 64 WL+SNLNKG+LDYFYWLLAVL Sbjct: 187 WLRSNLNKGRLDYFYWLLAVL 207 HSP 2 Score: 41.5874 bits (96), Expect = 1.912e-10 Identity = 22/41 (53.66%), Postives = 28/41 (68.29%), Query Frame = 1 Query: 64 GVLNFVLSLVLAMRPEYKAQHNNIETNDSIXKXLVIANGME 186 GV NF+ LVLAMR +YK QH+ + NDS K LV AN ++ Sbjct: 208 GVQNFIFFLVLAMRHQYKVQHST-KPNDSAEKELVSANDVK 247 The following BLAST results are available for this feature:
BLAST of FL512438 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FL512438 ID=FL512438; Name=FL512438; organism=Cicer arietinum; type=EST; length=472bpback to top |