GR420683
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR420683 vs. TrEMBL
Match: Q39450_CICAR (Pathogenesis related protein OS=Cicer arietinum GN=capr1 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.194e-9 Identity = 46/85 (54.12%), Postives = 52/85 (61.18%), Query Frame = -2 Query: 99 EANLGYNYSIVGGAGLSETVEK--FEANIM*RPKWRIGSIGKVNIK---PGKNKPNERRWKEVQERVMLGKARPLRVTFWPFQNP 338 EANLGYNYSIVGGAGLSETVE+ FEA + P GSIGKV++K G KPNE KEVQE G A + + NP Sbjct: 76 EANLGYNYSIVGGAGLSETVERYHFEAKLCEGPNG--GSIGKVSVKYQTKGDAKPNE---KEVQEGKAKGDALFKAIEGYVLANP 155
BLAST of GR420683 vs. TrEMBL
Match: C6T206_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 49.6766 bits (117), Expect = 2.242e-7 Identity = 30/61 (49.18%), Postives = 37/61 (60.66%), Query Frame = -2 Query: 171 EANLGYNYSIVGGAGLSETVEK--FEANIM*RPKWRIGSIGKVNIK---PGKNKPNERRWK 338 EAN GYNYS+VGG GL +TVEK FEA ++ P GSI K+ +K G P+E K Sbjct: 76 EANWGYNYSVVGGVGLPDTVEKISFEAKLVADPNG--GSIAKITVKYQTKGDANPSEEELK 134 HSP 2 Score: 28.8758 bits (63), Expect = 2.242e-7 Identity = 15/24 (62.50%), Postives = 18/24 (75.00%), Query Frame = -1 Query: 112 EEMEGGSRKGDAWKGKAIEGYVLA 183 EE++ G KGDA KA+EGYVLA Sbjct: 131 EELKSGKAKGDALF-KALEGYVLA 153 The following BLAST results are available for this feature:
BLAST of GR420683 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR420683 ID=GR420683; Name=GR420683; organism=Cicer arietinum; type=EST; length=384bpback to top |