DR749501

EST Overview
NameDR749501
Unique NameDR749501
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length516
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of DR749501 vs. SwissProt
Match: SKI11_ARATH (F-box/kelch-repeat protein SKIP11 OS=Arabidopsis thaliana GN=SKIP11 PE=1 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 3.386e-67
Identity = 122/170 (71.76%), Postives = 140/170 (82.35%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRG-SEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSE-GPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG DSK LTCG+EY+L+T+ WT+IP++SP RS    ++M   AEAPPLVAVVNN+LYAAD+ADMEV+KYDKE K W+T+GRLPERA S+NGWGLAFRACG RLIVIGGP+  G GFIELNSW+PS+ GPPQW LLDRK S  FVYNCAVMGC
Sbjct:  298 KMCSGVFMDGKFYVIGGIGGADSKGLTCGEEYDLETKKWTQIPDLSPPRSRADQADMSPAAEAPPLVAVVNNQLYAADHADMEVRKYDKENKKWLTVGRLPERAGSVNGWGLAFRACGERLIVIGGPKCSGGGFIELNSWIPSDGGPPQWTLLDRKHSPTFVYNCAVMGC 467          
BLAST of DR749501 vs. SwissProt
Match: FBK15_ARATH (F-box/kelch-repeat protein At1g26930 OS=Arabidopsis thaliana GN=At1g26930 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 4.735e-61
Identity = 111/171 (64.91%), Postives = 136/171 (79.53%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIG---GRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIG     + K+LTCG+E++L+TR WTEIP MSP RS++G+ M A A APPLVAVVN++LYAAD+A M V++YDKE+++W  +G LPE+A SMNGWGLAFRACG+R+IVIGGP+  GEGFIELNSWVPS   P+W LL +K+S NFVYNCAVM C
Sbjct:  251 KMCSGVFMDGKFYVIGGIGVGEENEPKVLTCGEEFDLKTRKWTEIPEMSPPRSNQGNGMSAAAMAPPLVAVVNDQLYAADHAGMAVRRYDKEKRVWNKVGNLPEQAGSMNGWGLAFRACGDRIIVIGGPKAPGEGFIELNSWVPSVTTPEWHLLGKKQSVNFVYNCAVMSC 421          
BLAST of DR749501 vs. SwissProt
Match: FBK29_ARATH (F-box/kelch-repeat protein At1g74510 OS=Arabidopsis thaliana GN=At1g74510 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 3.883e-55
Identity = 107/177 (60.45%), Postives = 127/177 (71.75%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRG--------SEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPP-QWRLLDRKRSGNFVYNCAVMGC 511
            KM S VFM G   C  GIG  +SK+L CG+ Y+L+ +TWT IPNM P RSS G        +   A +EAPPLVAVV +ELYAA+YA  EVKKYDK   +W  +G LPERA SMNGWG+AFRACG++L+V+GGPR  G GFIE+N+ VPSEG    WR+L  K SGNFVYNCAVMGC
Sbjct:  275 KMCSSVFMDGNFYCIGGIGEGNSKMLLCGEVYDLKKKTWTLIPNMLPERSSGGGGDQAKEIAAATAASEAPPLVAVVKDELYAANYAQQEVKKYDKRLNVWNKVGNLPERASSMNGWGMAFRACGDQLVVVGGPRAIGGGFIEINACVPSEGTQLHWRVLASKPSGNFVYNCAVMGC 451          
BLAST of DR749501 vs. SwissProt
Match: FK132_ARATH (F-box/kelch-repeat protein At5g60570 OS=Arabidopsis thaliana GN=At5g60570 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.198e-33
Identity = 78/174 (44.83%), Postives = 104/174 (59.77%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPR-THGEGFIELNSWVPSEGPP----QWRLLDRKRS-GNFVYNCAVMGC 511
            ++ SG FM GK     G+   +  + T G+E++L+TR W +I  M P        +   A+APPLV VVNNEL+  +Y+   VKKYDK +  W  +GRLP    S NGWGLAF+ CG++L+V  G R  HGEG + +NSW P  G       W++L  K + G FVYNCAVMGC
Sbjct:  229 RLCSGFFMDGKFYVIGGMSSPNVSV-TFGEEFDLETRKWRKIEGMYPN-------VNRAAQAPPLVVVVNNELFTLEYSTNMVKKYDKVKNKWEVMGRLPPMVDSSNGWGLAFKPCGDQLLVFCGQRGPHGEGIV-VNSWCPKSGAKDGNLDWKVLGVKENVGVFVYNCAVMGC 393          
BLAST of DR749501 vs. SwissProt
Match: FBK70_ARATH (F-box/kelch-repeat protein At3g27150 OS=Arabidopsis thaliana GN=At3g27150 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.225e-18
Identity = 58/175 (33.14%), Postives = 93/175 (53.14%), Query Frame = -3
Query:   14 KMFSGVFMYGKVLCYSGIGGRDS--KLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEG-FIELNSWVPSEGPPQ---WRLLDR---KRSGNFVYNCAVM 511
            K  SG ++ GK   +  +GGRD   + LTCG+ Y+ +T TW  IP++    S       ++ ++PPL+AVV ++LY+ + +  E++ YD     W  +G +P RA S  GWG+AF++ G++L+VIG          + + +  PS  P     W    R    R  +F+ NC VM
Sbjct:  255 KFCSGCYLRGK---FYVLGGRDENGQNLTCGESYDEKTNTWELIPDILKDMSF------SSVQSPPLIAVVGDDLYSLETSANELRVYDANANSWKKLGDVPVRAKSNGGWGVAFKSLGDKLLVIGASAGPSRAETMSVYTSRPSANPANKLYWEESKRCCGVRFNHFILNCCVM 420          
BLAST of DR749501 vs. TrEMBL
Match: B9T873_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0141700 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 1.804e-72
Identity = 134/170 (78.82%), Postives = 146/170 (85.88%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRS--SRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM S VFM GK     GIGG D+KLLTCG+EY+L+TR WTEIPNMSPGRS  +R  EMPA AEAPPLVAVVN+ELYAA   DMEVKKYDKERK+W+ +G LPERAVSMNGWGLAFRACG+RLIVIGGPRTHGEGFIELNSWVPSEGPPQW +L +K S NFVYNCAVMGC
Sbjct:  255 KMCSAVFMDGKFYVIGGIGGSDTKLLTCGEEYDLETRKWTEIPNMSPGRSGAAREIEMPAAAEAPPLVAVVNDELYAA--VDMEVKKYDKERKVWLVVGTLPERAVSMNGWGLAFRACGDRLIVIGGPRTHGEGFIELNSWVPSEGPPQWIMLAQKHSVNFVYNCAVMGC 422          
BLAST of DR749501 vs. TrEMBL
Match: Q6L3I4_SOLDE (Kelch repeat-containing F-box family protein, putative OS=Solanum demissum GN=SDM1_3t00006 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 2.438e-69
Identity = 123/169 (72.78%), Postives = 144/169 (85.21%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGR-SSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG +SKL+TC +EY+L T  WTEIPNMSP R ++  +++P T+EAPPLVAVVNN+LYAADYA MEV+KYDK+ K W++IGRLPERA SMNGWGLAFRACG+RLIV+GGPR  GEG+IE+NSWVPSEGPP+W LL RKRSG+FVYNCAVMGC
Sbjct:  345 KMCSGVFMDGKFYVIGGIGGAESKLMTCAEEYDLTTGKWTEIPNMSPVRPNATRNDIPVTSEAPPLVAVVNNQLYAADYAAMEVRKYDKQNKAWVSIGRLPERAASMNGWGLAFRACGDRLIVVGGPRVMGEGYIEVNSWVPSEGPPEWTLLGRKRSGSFVYNCAVMGC 513          
BLAST of DR749501 vs. TrEMBL
Match: Q9M9S9_ARATH (At1g14330/F14L17_7 OS=Arabidopsis thaliana GN=At1g14330 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 5.084e-67
Identity = 125/170 (73.53%), Postives = 138/170 (81.18%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPS--EGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG DSK+LTCG+E++L+T+ WTEIP MSP RS    EMPA AEAPPLVAVVNNELYAAD+ADMEV+KYDKE K W T+GRLPERA S+NGWGLAFRACG RLIVIGGPR+ G G+IELNSW+PS    PP W LL RK S NFVYNCAVMGC
Sbjct:  275 KMCSGVFMDGKFYVIGGIGGNDSKVLTCGEEFDLETKKWTEIPEMSPPRSR---EMPAAAEAPPLVAVVNNELYAADHADMEVRKYDKESKKWFTLGRLPERADSVNGWGLAFRACGERLIVIGGPRSSGGGYIELNSWIPSSDRSPPLWTLLGRKHSSNFVYNCAVMGC 441          
BLAST of DR749501 vs. TrEMBL
Match: D7LQA8_ARALY (Kelch repeat-containing F-box family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_484196 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.133e-66
Identity = 122/170 (71.76%), Postives = 142/170 (83.53%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRS-SRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSE-GPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG DSK+LTCG+EY+L+T+ WT+IP++SP RS +  ++M    EAPPLVAVVNN+LYAAD+ADMEV+KYDKE K W+T+GRLPERA S+NGWGLAFRACG RLIVIGGP+  G GFIELNSW+PS+ GPPQW LLDRK S NFVYNCAVMGC
Sbjct:  295 KMCSGVFMDGKFYVIGGIGGADSKVLTCGEEYDLETKKWTQIPDLSPPRSLADQADMSPAQEAPPLVAVVNNQLYAADHADMEVRKYDKENKKWLTVGRLPERAGSVNGWGLAFRACGERLIVIGGPKYSGGGFIELNSWIPSDGGPPQWTLLDRKHSPNFVYNCAVMGC 464          
BLAST of DR749501 vs. TrEMBL
Match: D7KBJ1_ARALY (Kelch repeat-containing F-box family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_471603 PE=4 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 1.479e-66
Identity = 124/170 (72.94%), Postives = 138/170 (81.18%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPS--EGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG DSK+LTCG+E++L+T+ WTEIP MSP RS    EMPA AEAPPLVAVVNN+LYAAD+ADMEV+KYDKE K W T+GRLPERA S+NGWGLAFRACG RLIVIGGPR+ G G+IELNSW+PS    PP W LL RK S NFVYNCAVMGC
Sbjct:  270 KMCSGVFMDGKFYVIGGIGGSDSKVLTCGEEFDLETKKWTEIPQMSPPRSR---EMPAAAEAPPLVAVVNNQLYAADHADMEVRKYDKESKKWFTLGRLPERAGSVNGWGLAFRACGERLIVIGGPRSSGGGYIELNSWIPSSDRSPPLWTLLGRKHSSNFVYNCAVMGC 436          
BLAST of DR749501 vs. TrEMBL
Match: D7SID7_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00008033001 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 2.211e-62
Identity = 117/168 (69.64%), Postives = 132/168 (78.57%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SG+FM  K     GIG  +S  LTCG+ Y+L+ RTW EIPNM PGR+        +A APPLVAVVNNELYAADYA+ EV+KYDK R LW+T+GRLPE+AVSMNGWGLAFRACG+RLIVIGGPR  G G IELNSW P EGPPQW LL RK+SG+FVYNCAVMGC
Sbjct:  322 KMCSGIFMDRKFYVIGGIGVGNSNSLTCGEVYDLEMRTWREIPNMFPGRNG-------SAGAPPLVAVVNNELYAADYAEKEVRKYDKARNLWVTVGRLPEQAVSMNGWGLAFRACGDRLIVIGGPRVLGGGIIELNSWSPGEGPPQWDLLARKQSGSFVYNCAVMGC 482          
BLAST of DR749501 vs. TrEMBL
Match: B9N4B4_POPTR (F-box family protein OS=Populus trichocarpa GN=POPTRDRAFT_926930 PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 2.887e-62
Identity = 115/170 (67.65%), Postives = 135/170 (79.41%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRG--SEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SG+FM GK     GIG  +SK+LTCG+ Y+L+TRTW EIP+M P ++     +E PA A APPLVAVVNNELYAADYA  EV+KYDK+  +WIT+GRLPE+AVSMNGWGLAFRACG+RLIVIGGPR  G G IEL+SW P +GPP+W LL  K SG+FVYNCAVMGC
Sbjct:  274 KMCSGLFMDGKFYVIGGIGAGNSKMLTCGEAYDLKTRTWHEIPDMLPAQNGGAVVTETPAAAGAPPLVAVVNNELYAADYAQKEVRKYDKKNNVWITLGRLPEQAVSMNGWGLAFRACGDRLIVIGGPRALGGGMIELHSWAPGDGPPKWDLLASKPSGSFVYNCAVMGC 443          
BLAST of DR749501 vs. TrEMBL
Match: B9R978_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1514730 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 3.771e-62
Identity = 116/170 (68.24%), Postives = 133/170 (78.24%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRS--SRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     G G  ++K+LTCG+ Y+L T+TW  IP+M P R+  +  +E PA AEAPPLVAVVNNELYAADYA  EV+KYDK + LWI +G LPE  VSMNGWGLAFRACG+RLIVIGGPRT G G IELNSWVP EGPP+W LL +K SG+FVYNCAVMGC
Sbjct:  390 KMCSGVFMDGKFYVIGGTGTGNTKMLTCGEVYDLATKTWLVIPDMFPARNGGTGRNETPAAAEAPPLVAVVNNELYAADYAHKEVRKYDKRKNLWIALGGLPEHVVSMNGWGLAFRACGDRLIVIGGPRTLGGGMIELNSWVPGEGPPKWNLLAKKPSGSFVYNCAVMGC 559          
BLAST of DR749501 vs. TrEMBL
Match: A5AXW4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_022021 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.097e-61
Identity = 116/167 (69.46%), Postives = 130/167 (77.84%), Query Frame = -3
Query:   20 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGS---EMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCA 511
            KM SG+FM  K     GIG  +S  LTCG+ Y+L+ RTW EIPNM PGR+         PA AEAPPLVAVVNNELYAADYA+ EV+KYDK R LW+T+GRLPE+AVSMNGWGLAFRACG+RLIVIGGPR  G G IELNSW P EGPPQW LL RK+SG+FVYNCA
Sbjct:  273 KMCSGIFMDRKFYVIGGIGVGNSNSLTCGEVYDLEMRTWREIPNMFPGRNGSAGVAEATPAAAEAPPLVAVVNNELYAADYAEKEVRKYDKARNLWVTVGRLPEQAVSMNGWGLAFRACGDRLIVIGGPRVLGGGIIELNSWSPGEGPPQWDLLARKQSGSFVYNCA 439          
BLAST of DR749501 vs. TrEMBL
Match: D7KPM7_ARALY (Kelch repeat-containing F-box family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_472706 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.871e-61
Identity = 112/171 (65.50%), Postives = 138/171 (80.70%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIG---GRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIG   G + K+LTCG+E++L+TR WTEIP MSP RS++G+ M A A APPLVAVVN++LYAAD+A M V++YDKE+++W  +G LPE+A SMNGWGLAFRACG+R+IVIGGP+  GEGFIELNSWVPS+  P+W LL +K+S NFVYNCAVM C
Sbjct:  252 KMCSGVFMDGKFYVIGGIGIGEGNEPKVLTCGEEFDLKTRKWTEIPEMSPPRSNQGNGMSAAAMAPPLVAVVNDQLYAADHAGMAVRRYDKEKRVWNKVGNLPEQAGSMNGWGLAFRACGDRVIVIGGPKAPGEGFIELNSWVPSDATPEWHLLGKKQSVNFVYNCAVMSC 422          
BLAST of DR749501 vs. TAIR peptide
Match: AT1G14330.1 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr1:4890375-4891700 REVERSE LENGTH=441)

HSP 1 Score: 256.914 bits (655), Expect = 4.446e-69
Identity = 125/170 (73.53%), Postives = 138/170 (81.18%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPS--EGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG DSK+LTCG+E++L+T+ WTEIP MSP RS    EMPA AEAPPLVAVVNNELYAAD+ADMEV+KYDKE K W T+GRLPERA S+NGWGLAFRACG RLIVIGGPR+ G G+IELNSW+PS    PP W LL RK S NFVYNCAVMGC
Sbjct:  275 KMCSGVFMDGKFYVIGGIGGNDSKVLTCGEEFDLETKKWTEIPEMSPPRSR---EMPAAAEAPPLVAVVNNELYAADHADMEVRKYDKESKKWFTLGRLPERADSVNGWGLAFRACGERLIVIGGPRSSGGGYIELNSWIPSSDRSPPLWTLLGRKHSSNFVYNCAVMGC 441          
BLAST of DR749501 vs. TAIR peptide
Match: AT2G02870.3 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr2:838378-839781 FORWARD LENGTH=467)

HSP 1 Score: 253.832 bits (647), Expect = 3.764e-68
Identity = 122/170 (71.76%), Postives = 140/170 (82.35%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRG-SEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSE-GPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG DSK LTCG+EY+L+T+ WT+IP++SP RS    ++M   AEAPPLVAVVNN+LYAAD+ADMEV+KYDKE K W+T+GRLPERA S+NGWGLAFRACG RLIVIGGP+  G GFIELNSW+PS+ GPPQW LLDRK S  FVYNCAVMGC
Sbjct:  298 KMCSGVFMDGKFYVIGGIGGADSKGLTCGEEYDLETKKWTQIPDLSPPRSRADQADMSPAAEAPPLVAVVNNQLYAADHADMEVRKYDKENKKWLTVGRLPERAGSVNGWGLAFRACGERLIVIGGPKCSGGGFIELNSWIPSDGGPPQWTLLDRKHSPTFVYNCAVMGC 467          
BLAST of DR749501 vs. TAIR peptide
Match: AT2G02870.2 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr2:838378-839781 FORWARD LENGTH=467)

HSP 1 Score: 253.832 bits (647), Expect = 3.764e-68
Identity = 122/170 (71.76%), Postives = 140/170 (82.35%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRG-SEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSE-GPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG DSK LTCG+EY+L+T+ WT+IP++SP RS    ++M   AEAPPLVAVVNN+LYAAD+ADMEV+KYDKE K W+T+GRLPERA S+NGWGLAFRACG RLIVIGGP+  G GFIELNSW+PS+ GPPQW LLDRK S  FVYNCAVMGC
Sbjct:  298 KMCSGVFMDGKFYVIGGIGGADSKGLTCGEEYDLETKKWTQIPDLSPPRSRADQADMSPAAEAPPLVAVVNNQLYAADHADMEVRKYDKENKKWLTVGRLPERAGSVNGWGLAFRACGERLIVIGGPKCSGGGFIELNSWIPSDGGPPQWTLLDRKHSPTFVYNCAVMGC 467          
BLAST of DR749501 vs. TAIR peptide
Match: AT2G02870.1 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr2:838378-839781 FORWARD LENGTH=467)

HSP 1 Score: 253.832 bits (647), Expect = 3.764e-68
Identity = 122/170 (71.76%), Postives = 140/170 (82.35%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRG-SEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSE-GPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIGG DSK LTCG+EY+L+T+ WT+IP++SP RS    ++M   AEAPPLVAVVNN+LYAAD+ADMEV+KYDKE K W+T+GRLPERA S+NGWGLAFRACG RLIVIGGP+  G GFIELNSW+PS+ GPPQW LLDRK S  FVYNCAVMGC
Sbjct:  298 KMCSGVFMDGKFYVIGGIGGADSKGLTCGEEYDLETKKWTQIPDLSPPRSRADQADMSPAAEAPPLVAVVNNQLYAADHADMEVRKYDKENKKWLTVGRLPERAGSVNGWGLAFRACGERLIVIGGPKCSGGGFIELNSWIPSDGGPPQWTLLDRKHSPTFVYNCAVMGC 467          
BLAST of DR749501 vs. TAIR peptide
Match: AT1G26930.1 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr1:9336211-9337476 REVERSE LENGTH=421)

HSP 1 Score: 233.417 bits (594), Expect = 5.264e-62
Identity = 111/171 (64.91%), Postives = 136/171 (79.53%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIG---GRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPPQWRLLDRKRSGNFVYNCAVMGC 511
            KM SGVFM GK     GIG     + K+LTCG+E++L+TR WTEIP MSP RS++G+ M A A APPLVAVVN++LYAAD+A M V++YDKE+++W  +G LPE+A SMNGWGLAFRACG+R+IVIGGP+  GEGFIELNSWVPS   P+W LL +K+S NFVYNCAVM C
Sbjct:  251 KMCSGVFMDGKFYVIGGIGVGEENEPKVLTCGEEFDLKTRKWTEIPEMSPPRSNQGNGMSAAAMAPPLVAVVNDQLYAADHAGMAVRRYDKEKRVWNKVGNLPEQAGSMNGWGLAFRACGDRIIVIGGPKAPGEGFIELNSWVPSVTTPEWHLLGKKQSVNFVYNCAVMSC 421          
BLAST of DR749501 vs. TAIR peptide
Match: AT1G74510.1 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr1:28006065-28007420 FORWARD LENGTH=451)

HSP 1 Score: 213.772 bits (543), Expect = 4.316e-56
Identity = 107/177 (60.45%), Postives = 127/177 (71.75%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRG--------SEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPP-QWRLLDRKRSGNFVYNCAVMGC 511
            KM S VFM G   C  GIG  +SK+L CG+ Y+L+ +TWT IPNM P RSS G        +   A +EAPPLVAVV +ELYAA+YA  EVKKYDK   +W  +G LPERA SMNGWG+AFRACG++L+V+GGPR  G GFIE+N+ VPSEG    WR+L  K SGNFVYNCAVMGC
Sbjct:  275 KMCSSVFMDGNFYCIGGIGEGNSKMLLCGEVYDLKKKTWTLIPNMLPERSSGGGGDQAKEIAAATAASEAPPLVAVVKDELYAANYAQQEVKKYDKRLNVWNKVGNLPERASSMNGWGMAFRACGDQLVVVGGPRAIGGGFIEINACVPSEGTQLHWRVLASKPSGNFVYNCAVMGC 451          
BLAST of DR749501 vs. TAIR peptide
Match: AT1G74510.2 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr1:28006065-28007420 FORWARD LENGTH=451)

HSP 1 Score: 213.772 bits (543), Expect = 4.316e-56
Identity = 107/177 (60.45%), Postives = 127/177 (71.75%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRG--------SEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSWVPSEGPP-QWRLLDRKRSGNFVYNCAVMGC 511
            KM S VFM G   C  GIG  +SK+L CG+ Y+L+ +TWT IPNM P RSS G        +   A +EAPPLVAVV +ELYAA+YA  EVKKYDK   +W  +G LPERA SMNGWG+AFRACG++L+V+GGPR  G GFIE+N+ VPSEG    WR+L  K SGNFVYNCAVMGC
Sbjct:  275 KMCSSVFMDGNFYCIGGIGEGNSKMLLCGEVYDLKKKTWTLIPNMLPERSSGGGGDQAKEIAAATAASEAPPLVAVVKDELYAANYAQQEVKKYDKRLNVWNKVGNLPERASSMNGWGMAFRACGDQLVVVGGPRAIGGGFIEINACVPSEGTQLHWRVLASKPSGNFVYNCAVMGC 451          
BLAST of DR749501 vs. TAIR peptide
Match: AT5G60570.1 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr5:24348713-24349894 FORWARD LENGTH=393)

HSP 1 Score: 140.969 bits (354), Expect = 3.555e-34
Identity = 78/174 (44.83%), Postives = 104/174 (59.77%), Query Frame = -3
Query:    8 KMFSGVFMYGKVLCYSGIGGRDSKLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPR-THGEGFIELNSWVPSEGPP----QWRLLDRKRS-GNFVYNCAVMGC 511
            ++ SG FM GK     G+   +  + T G+E++L+TR W +I  M P        +   A+APPLV VVNNEL+  +Y+   VKKYDK +  W  +GRLP    S NGWGLAF+ CG++L+V  G R  HGEG + +NSW P  G       W++L  K + G FVYNCAVMGC
Sbjct:  229 RLCSGFFMDGKFYVIGGMSSPNVSV-TFGEEFDLETRKWRKIEGMYPN-------VNRAAQAPPLVVVVNNELFTLEYSTNMVKKYDKVKNKWEVMGRLPPMVDSSNGWGLAFKPCGDQLLVFCGQRGPHGEGIV-VNSWCPKSGAKDGNLDWKVLGVKENVGVFVYNCAVMGC 393          
BLAST of DR749501 vs. TAIR peptide
Match: AT3G27150.1 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr3:10009692-10010960 REVERSE LENGTH=422)

HSP 1 Score: 91.6633 bits (226), Expect = 2.474e-19
Identity = 58/175 (33.14%), Postives = 93/175 (53.14%), Query Frame = -3
Query:   14 KMFSGVFMYGKVLCYSGIGGRDS--KLLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEG-FIELNSWVPSEGPPQ---WRLLDR---KRSGNFVYNCAVM 511
            K  SG ++ GK   +  +GGRD   + LTCG+ Y+ +T TW  IP++    S       ++ ++PPL+AVV ++LY+ + +  E++ YD     W  +G +P RA S  GWG+AF++ G++L+VIG          + + +  PS  P     W    R    R  +F+ NC VM
Sbjct:  255 KFCSGCYLRGK---FYVLGGRDENGQNLTCGESYDEKTNTWELIPDILKDMSF------SSVQSPPLIAVVGDDLYSLETSANELRVYDANANSWKKLGDVPVRAKSNGGWGVAFKSLGDKLLVIGASAGPSRAETMSVYTSRPSANPANKLYWEESKRCCGVRFNHFILNCCVM 420          
BLAST of DR749501 vs. TAIR peptide
Match: AT5G40680.1 (| Symbols: | Galactose oxidase/kelch repeat superfamily protein | chr5:16288754-16290001 FORWARD LENGTH=415)

HSP 1 Score: 83.1889 bits (204), Expect = 8.798e-17
Identity = 58/181 (32.04%), Postives = 86/181 (47.51%), Query Frame = -3
Query:   14 KMFSGVFMYGKVLCYSGIGGRDSK--LLTCGDEYNLQTRTWTEIPNMSPGRSSRGSEMPATAEAPPLVAVVNNELYAADYADMEVKKYDKERKLWITIGRLPERAVSMNGWGLAFRACGNRLIVIGGPRTHGEGFIELNSW-----------VPSEGPPQWR--LLDRKRSGNFVYNCAVM 511
            K  SG F+ GK   +  +GGRD     LTCG+ Y+  T +W  IP+M  G +    +      +PPL+AVV + LY  +    E+  YD    +W  +G +P +A +  GWG+AF++ G+R++VIG   T         SW            P      W     D  + G+F+ NC VM
Sbjct:  250 KFSSGCFLRGK---FYALGGRDENDVYLTCGESYDELTDSWKLIPDMLKGMTFMNPQ------SPPLIAVVKDNLYLLETWLNELWVYDINANVWKNLGVVPVKANAALGWGVAFKSVGDRILVIGASVT--------KSWDNKMSVYTCCPFPKVEKITWEETSCDCVQLGHFIRNCCVM 413          
The following BLAST results are available for this feature:
BLAST of DR749501 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 5
Match NameE-valueIdentityDescription
SKI11_ARATH3.386e-6771.76F-box/kelch-repeat protein SKIP11 OS=Arabidopsis t... [more]
FBK15_ARATH4.735e-6164.91F-box/kelch-repeat protein At1g26930 OS=Arabidopsi... [more]
FBK29_ARATH3.883e-5560.45F-box/kelch-repeat protein At1g74510 OS=Arabidopsi... [more]
FK132_ARATH3.198e-3344.83F-box/kelch-repeat protein At5g60570 OS=Arabidopsi... [more]
FBK70_ARATH2.225e-1833.14F-box/kelch-repeat protein At3g27150 OS=Arabidopsi... [more]
back to top
BLAST of DR749501 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B9T873_RICCO1.804e-7278.82Putative uncharacterized protein OS=Ricinus commun... [more]
Q6L3I4_SOLDE2.438e-6972.78Kelch repeat-containing F-box family protein, puta... [more]
Q9M9S9_ARATH5.084e-6773.53At1g14330/F14L17_7 OS=Arabidopsis thaliana GN=At1g... [more]
D7LQA8_ARALY1.133e-6671.76Kelch repeat-containing F-box family protein OS=Ar... [more]
D7KBJ1_ARALY1.479e-6672.94Kelch repeat-containing F-box family protein OS=Ar... [more]
D7SID7_VITVI2.211e-6269.64Whole genome shotgun sequence of line PN40024, sca... [more]
B9N4B4_POPTR2.887e-6267.65F-box family protein OS=Populus trichocarpa GN=POP... [more]
B9R978_RICCO3.771e-6268.24Putative uncharacterized protein OS=Ricinus commun... [more]
A5AXW4_VITVI1.097e-6169.46Putative uncharacterized protein OS=Vitis vinifera... [more]
D7KPM7_ARALY1.871e-6165.50Kelch repeat-containing F-box family protein OS=Ar... [more]
back to top
BLAST of DR749501 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT1G14330.14.446e-6973.53| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT2G02870.33.764e-6871.76| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT2G02870.23.764e-6871.76| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT2G02870.13.764e-6871.76| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT1G26930.15.264e-6264.91| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT1G74510.14.316e-5660.45| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT1G74510.24.316e-5660.45| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT5G60570.13.555e-3444.83| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT3G27150.12.474e-1933.14| Symbols: | Galactose oxidase/kelch repeat super... [more]
AT5G40680.18.798e-1732.04| Symbols: | Galactose oxidase/kelch repeat super... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015916Galactose oxidase, beta-propellerGENE3D2.130.10.80no descriptioncoord: 19..157
score: 3.3
NoneNo IPR availableSUPERFAMILY117281Kelch motifcoord: 4..167
score: 1.1

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>DR749501 ID=DR749501|Name=DR749501|organism=Cicer arietinum|type=EST|length=516bp
GACCTCCGCAACCCATCACAGCACAATTATAGACAAAGTTACCCGATCGT
TTTCGATCTAGTAATCGCCATTGCGGAGGTCCTTCACTAGGCACCCAGGA
ATTGAGTTCAATGAAACCCTCGCCGTGAGTCCTAGGTCCACCAATGACAA
TAAGCCTATTTCCACATGCCCTAAATGCAAGTCCCCAACCGTTCATCGAC
ACCGCGCGTTCCGGAAGTCTCCCAATTGTAATCCACAACTTTCTTTCCTT
GTCATACTTTTTAACTTCCATGTCAGCATAATCAGCGGCGTATAATTCAT
TATTTACAACAGCAACAAGAGGTGGTGCCTCGGCAGTTGCAGGCATCTCA
GACCCCCTACTGCTTCGTCCGGGTGACATGTTAGGAATTTCCGTCCATGT
TCTGGTTTGTAAATTGTACTCATCGCCGCATGTTAGAAGCTTGGAATCGC
GGCCGCCGATCCCGCTATAACATAAAACTTTTCCGTACATGAATACCCCA
GAAAACATTTTCCCTT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR015916Gal_Oxidase_b-propeller