DR749500

EST Overview
NameDR749500
Unique NameDR749500
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length369
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of DR749500 vs. SwissProt
Match: GSH1_MEDTR (Glutamate--cysteine ligase, chloroplastic OS=Medicago truncatula GN=GSH1 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 1.103e-62
Identity = 109/113 (96.46%), Postives = 112/113 (99.12%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFTDGKPNGFVSMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVD+ALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGE+PTLNDWENHLTTIFPEV
Sbjct:  260 ALQPIATALFANSPFTDGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDFALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEV 372          
BLAST of DR749500 vs. SwissProt
Match: GSH1_ARATH (Glutamate--cysteine ligase, chloroplastic OS=Arabidopsis thaliana GN=GSH1 PE=1 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 2.543e-59
Identity = 102/113 (90.27%), Postives = 108/113 (95.58%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGF+SMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YRK KYIDCTGMTFR FLAGKLPC+PGE+P+ NDWENHLTTIFPEV
Sbjct:  274 ALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEV 386          
BLAST of DR749500 vs. SwissProt
Match: GSH1_BRAJU (Glutamate--cysteine ligase, chloroplastic OS=Brassica juncea GN=GSH1 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 7.398e-59
Identity = 101/113 (89.38%), Postives = 107/113 (94.69%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGF+SMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YR  KY+DCTGMTFR FLAGKLPC+PGE+PT NDWENHLTTIFPEV
Sbjct:  266 ALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEV 378          
BLAST of DR749500 vs. SwissProt
Match: GSH1_SOLLC (Glutamate--cysteine ligase, chloroplastic OS=Solanum lycopersicum GN=GSH1 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 4.060e-57
Identity = 99/113 (87.61%), Postives = 106/113 (93.81%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNG++S RSHIWTDTD NR GMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKY+DCTG++FRDF+ GKLP IPGE PTLNDWENHLTTIFPEV
Sbjct:  275 ALQPIATALFANSPFTEGKPNGYLSKRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYVDCTGLSFRDFMNGKLPPIPGEYPTLNDWENHLTTIFPEV 387          
BLAST of DR749500 vs. SwissProt
Match: GSH1_TOBAC (Glutamate--cysteine ligase, chloroplastic OS=Nicotiana tabacum GN=GSH1 PE=2 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 2.015e-56
Identity = 99/113 (87.61%), Postives = 105/113 (92.92%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNG++SMRSHIWTDTD NR GMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDC GM+FRDF+ GKL  IPG+ PTLNDWENHLTTIFPEV
Sbjct:  274 ALQPIATALFANSPFTEGKPNGYLSMRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFMNGKLSPIPGDYPTLNDWENHLTTIFPEV 386          
BLAST of DR749500 vs. SwissProt
Match: GSH1B_ORYSJ (Glutamate--cysteine ligase B, chloroplastic OS=Oryza sativa subsp. japonica GN=GSH1-2 PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 4.488e-56
Identity = 96/113 (84.96%), Postives = 106/113 (93.81%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATA+FAN PF +GKPNG++S+RSHIWTDTD NR+GMLPFVFDDSFGFE+YVDYALDVPMYFVYR KKYIDCTGM+FRDF+ GKLP  PGE+PTLNDWENHLTTIFPEV
Sbjct:  248 ALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEV 360          
BLAST of DR749500 vs. SwissProt
Match: GSH1B_ORYSI (Glutamate--cysteine ligase B, chloroplastic OS=Oryza sativa subsp. indica GN=GSH1-2 PE=3 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 4.488e-56
Identity = 96/113 (84.96%), Postives = 106/113 (93.81%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATA+FAN PF +GKPNG++S+RSHIWTDTD NR+GMLPFVFDDSFGFE+YVDYALDVPMYFVYR KKYIDCTGM+FRDF+ GKLP  PGE+PTLNDWENHLTTIFPEV
Sbjct:  248 ALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEV 360          
BLAST of DR749500 vs. SwissProt
Match: GSH1A_ORYSI (Glutamate--cysteine ligase A, chloroplastic OS=Oryza sativa subsp. indica GN=GSH1-1 PE=2 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 4.488e-56
Identity = 96/113 (84.96%), Postives = 106/113 (93.81%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATA+FAN PF +GKPNG++S+RSHIWTDTD NR+GMLPFVFDDSFGFE+YVDYALDVPMYFVYR KKYIDCTGM+FRDF+ GKLP  PGE+PTLNDWENHLTTIFPEV
Sbjct:  244 ALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEV 356          
BLAST of DR749500 vs. SwissProt
Match: GSH1A_ORYSJ (Glutamate--cysteine ligase A, chloroplastic OS=Oryza sativa subsp. japonica GN=GSH1-1 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.862e-56
Identity = 95/113 (84.07%), Postives = 106/113 (93.81%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATA+FAN PF +GKPNG++S+RSHIWTDTD NR+GMLPFVFDDSFGFE+YVDYALD+PMYFVYR KKYIDCTGM+FRDF+ GKLP  PGE+PTLNDWENHLTTIFPEV
Sbjct:  244 ALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDIPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEV 356          
BLAST of DR749500 vs. TrEMBL
Match: Q9SEH0_PEA (Gamma-glutamylcysteine synthetase OS=Pisum sativum GN=gsh1 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 8.575e-61
Identity = 107/113 (94.69%), Postives = 111/113 (98.23%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGFVSMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YRKKKY+DCTGMTFRDFLAGKLPCIPGE+PTLNDWENHLTTIFPEV
Sbjct:  251 ALQPIATALFANSPFTEGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRKKKYVDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEV 363          
BLAST of DR749500 vs. TrEMBL
Match: A6XHG9_FAGSY (Putative gamma-glutamylcysteine synthetase (Fragment) OS=Fagus sylvatica GN=ECS PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.256e-60
Identity = 106/113 (93.81%), Postives = 111/113 (98.23%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNG++S RSHIWTDTDKNR+GMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGE+PTLNDWENHLTTIFPEV
Sbjct:   57 ALQPIATALFANSPFTEGKPNGYLSKRSHIWTDTDKNRSGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEV 169          
BLAST of DR749500 vs. TrEMBL
Match: B9RCB6_RICCO (Glutamate--cysteine ligase, chloroplast, putative OS=Ricinus communis GN=RCOM_1686670 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 9.481e-60
Identity = 106/113 (93.81%), Postives = 111/113 (98.23%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNG++SMRS IWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGE+PTLNDWENHLTTIFPEV
Sbjct:  278 ALQPIATALFANSPFTEGKPNGYLSMRSQIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEV 390          
BLAST of DR749500 vs. TrEMBL
Match: Q6XXZ2_LOTJA (Gamma-glutamylcysteine synthetase OS=Lotus japonicus PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 3.603e-59
Identity = 105/113 (92.92%), Postives = 110/113 (97.35%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PF +GKPNG+VSMRSHIWTDTDK+R+GMLPFVFDDSFGFEQYVDYALDVPMYFVYRK KYIDCTGMTFRDFLAGKLPCIPGE+PTLNDWENHLTTIFPEV
Sbjct:  247 ALQPIATALFANSPFKEGKPNGYVSMRSHIWTDTDKDRSGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKHKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEV 359          
BLAST of DR749500 vs. TrEMBL
Match: Q9SEH1_PHAVU (Gamma-glutamylcysteine synthetase OS=Phaseolus vulgaris GN=gsh1 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.369e-58
Identity = 104/113 (92.04%), Postives = 109/113 (96.46%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PF +GKPNGFVSMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRK +YIDCTG TFRDFLAG+LPCIPGE+PTLNDWENHLTTIFPEV
Sbjct:  260 ALQPIATALFANSPFKEGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKHRYIDCTGKTFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEV 372          
BLAST of DR749500 vs. TrEMBL
Match: Q7Y0R3_BRAJU (Glutamate-cysteine ligase OS=Brassica juncea GN=gsh1 PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.335e-58
Identity = 102/113 (90.27%), Postives = 108/113 (95.58%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGF+SMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YR KKY+DCTGMTFR FLAGKLPC+PGE+PT NDWENHLTTIFPEV
Sbjct:  267 ALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEV 379          
BLAST of DR749500 vs. TrEMBL
Match: B9GKI0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_709341 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.335e-58
Identity = 102/113 (90.27%), Postives = 110/113 (97.35%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNG++S+RSHIWTDTD NR GMLPFVF+D+FGFEQYVDYALDVPMYFVYRKKKYIDCTGM+FRDFLAGKLPCIPGE+PTLNDWENHLTTIFPEV
Sbjct:  278 ALQPIATALFANSPFTEGKPNGYLSLRSHIWTDTDNNRAGMLPFVFNDTFGFEQYVDYALDVPMYFVYRKKKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEV 390          
BLAST of DR749500 vs. TrEMBL
Match: B6EU03_BRANA (Putative glutamyl cysteine ligase OS=Brassica napus GN=ecs2 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.335e-58
Identity = 102/113 (90.27%), Postives = 108/113 (95.58%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGF+SMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YR KKY+DCTGMTFR FLAGKLPC+PGE+PT NDWENHLTTIFPEV
Sbjct:  255 ALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEV 367          
BLAST of DR749500 vs. TrEMBL
Match: B9GWI2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_830837 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 3.050e-58
Identity = 102/113 (90.27%), Postives = 109/113 (96.46%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFTDGKPNG++S RSHIWTDTD NR GMLPFVFDD+FGFEQYVDYALDVPMYFVYRK+KYIDCTGM+FRDFLAG+LPCIPGE+PTLNDWENHLTTIFPEV
Sbjct:  278 ALQPIATALFANSPFTDGKPNGYLSKRSHIWTDTDNNRAGMLPFVFDDNFGFEQYVDYALDVPMYFVYRKEKYIDCTGMSFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEV 390          
BLAST of DR749500 vs. TrEMBL
Match: Q2V3F8_ARATH (Putative uncharacterized protein At4g23100.2 OS=Arabidopsis thaliana GN=At4g23100 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 5.202e-58
Identity = 102/113 (90.27%), Postives = 108/113 (95.58%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGF+SMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YRK KYIDCTGMTFR FLAGKLPC+PGE+P+ NDWENHLTTIFPEV
Sbjct:  274 ALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEV 386          
BLAST of DR749500 vs. TAIR peptide
Match: AT4G23100.3 (| Symbols: GSH1 | glutamate-cysteine ligase | chr4:12103458-12106751 REVERSE LENGTH=522)

HSP 1 Score: 226.868 bits (577), Expect = 2.246e-60
Identity = 102/113 (90.27%), Postives = 108/113 (95.58%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGF+SMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YRK KYIDCTGMTFR FLAGKLPC+PGE+P+ NDWENHLTTIFPEV
Sbjct:  274 ALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEV 386          
BLAST of DR749500 vs. TAIR peptide
Match: AT4G23100.2 (| Symbols: RML1, PAD2, GSH1, CAD2 | glutamate-cysteine ligase | chr4:12103779-12106751 REVERSE LENGTH=477)

HSP 1 Score: 226.868 bits (577), Expect = 2.246e-60
Identity = 102/113 (90.27%), Postives = 108/113 (95.58%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGF+SMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YRK KYIDCTGMTFR FLAGKLPC+PGE+P+ NDWENHLTTIFPEV
Sbjct:  274 ALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEV 386          
BLAST of DR749500 vs. TAIR peptide
Match: AT4G23100.1 (| Symbols: RML1, PAD2, GSH1, CAD2, ATECS1, GSHA | glutamate-cysteine ligase | chr4:12103458-12106751 REVERSE LENGTH=522)

HSP 1 Score: 226.868 bits (577), Expect = 2.246e-60
Identity = 102/113 (90.27%), Postives = 108/113 (95.58%), Query Frame = -1
Query:   31 ALQPIATALFANPPFTDGKPNGFVSMRSHIWTDTDKNRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEIPTLNDWENHLTTIFPEV 369
            ALQPIATALFAN PFT+GKPNGF+SMRSHIWTDTDK+RTGMLPFVFDDSFGFEQYVDYALDVPMYF YRK KYIDCTGMTFR FLAGKLPC+PGE+P+ NDWENHLTTIFPEV
Sbjct:  274 ALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEV 386          
The following BLAST results are available for this feature:
BLAST of DR749500 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot)
Total hits: 9
Match NameE-valueIdentityDescription
GSH1_MEDTR1.103e-6296.46Glutamate--cysteine ligase, chloroplastic OS=Medic... [more]
GSH1_ARATH2.543e-5990.27Glutamate--cysteine ligase, chloroplastic OS=Arabi... [more]
GSH1_BRAJU7.398e-5989.38Glutamate--cysteine ligase, chloroplastic OS=Brass... [more]
GSH1_SOLLC4.060e-5787.61Glutamate--cysteine ligase, chloroplastic OS=Solan... [more]
GSH1_TOBAC2.015e-5687.61Glutamate--cysteine ligase, chloroplastic OS=Nicot... [more]
GSH1B_ORYSJ4.488e-5684.96Glutamate--cysteine ligase B, chloroplastic OS=Ory... [more]
GSH1B_ORYSI4.488e-5684.96Glutamate--cysteine ligase B, chloroplastic OS=Ory... [more]
GSH1A_ORYSI4.488e-5684.96Glutamate--cysteine ligase A, chloroplastic OS=Ory... [more]
GSH1A_ORYSJ5.862e-5684.07Glutamate--cysteine ligase A, chloroplastic OS=Ory... [more]
back to top
BLAST of DR749500 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q9SEH0_PEA8.575e-6194.69Gamma-glutamylcysteine synthetase OS=Pisum sativum... [more]
A6XHG9_FAGSY4.256e-6093.81Putative gamma-glutamylcysteine synthetase (Fragme... [more]
B9RCB6_RICCO9.481e-6093.81Glutamate--cysteine ligase, chloroplast, putative ... [more]
Q6XXZ2_LOTJA3.603e-5992.92Gamma-glutamylcysteine synthetase OS=Lotus japonic... [more]
Q9SEH1_PHAVU1.369e-5892.04Gamma-glutamylcysteine synthetase OS=Phaseolus vul... [more]
Q7Y0R3_BRAJU2.335e-5890.27Glutamate-cysteine ligase OS=Brassica juncea GN=gs... [more]
B9GKI0_POPTR2.335e-5890.27Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B6EU03_BRANA2.335e-5890.27Putative glutamyl cysteine ligase OS=Brassica napu... [more]
B9GWI2_POPTR3.050e-5890.27Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q2V3F8_ARATH5.202e-5890.27Putative uncharacterized protein At4g23100.2 OS=Ar... [more]
back to top
BLAST of DR749500 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT4G23100.32.246e-6090.27| Symbols: GSH1 | glutamate-cysteine ligase | chr4... [more]
AT4G23100.22.246e-6090.27| Symbols: RML1, PAD2, GSH1, CAD2 | glutamate-cyst... [more]
AT4G23100.12.246e-6090.27| Symbols: RML1, PAD2, GSH1, CAD2, ATECS1, GSHA | ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006336Glutamate--cysteine ligase, GCS2PFAMPF04107GCS2coord: 1..116
score: 3.3
NoneNo IPR availableSUPERFAMILY55931Glutamine synthetase/guanido kinasecoord: 1..113
score: 4.3

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>DR749500 ID=DR749500|Name=DR749500|organism=Cicer arietinum|type=EST|length=369bp
CGCCGCATGTTTGCGCGGGAATCGATTTGTGACCTCAGGAAATATAGTGG
TCAAATGATTCTCCCAATCATTGAGAGTTGGTATTTCACCAGGAATACAA
GGAAGCTTTCCTGCCAAGAAGTCCCTGAAGGTCATTCCAGTACAGTCGAT
GTACTTCTTTTTCCGATAGACAAAATACATTGGAACATCAAGAGCATAAT
CAACGTACTGCTCAAACCCGAAGGAGTCATCAAAAACAAAAGGCAGCATG
CCTGTGCGGTTCTTATCAGTGTCAGTCCAAATATGACTTCTCATACTGAC
AAATCCATTGGGCTTTCCATCTGTGAAGGGTGGATTTGCAAAAAGAGCTG
TTGCAATAGGTTGCAAAGC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0004357glutamate-cysteine ligase activity
Vocabulary: Biological Process
TermDefinition
GO:0006750glutathione biosynthetic process
Vocabulary: INTERPRO
TermDefinition
IPR006336GCS2