GO660540
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GO660540 vs. TrEMBL
Match: Q45RR9_SOYBN (Plastid division regulator MinE OS=Glycine max PE=2 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 1.984e-17 Identity = 44/50 (88.00%), Postives = 46/50 (92.00%), Query Frame = 1 Query: 13 QFTPKCPYLTIVRCNMRGYCKPVFAVLGGPKFSSKSVISQEAENFLLDAV 162 +FTPKCPYLTIVRCNMRGYCKPV AVLGGPKF+S SV SQE ENFLLDAV Sbjct: 47 EFTPKCPYLTIVRCNMRGYCKPVAAVLGGPKFTSNSV-SQETENFLLDAV 95
BLAST of GO660540 vs. TrEMBL
Match: C6SWX7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 1.422e-15 Identity = 42/50 (84.00%), Postives = 44/50 (88.00%), Query Frame = 1 Query: 13 QFTPKCPYLTIVRCNMRGYCKPVFAVLGGPKFSSKSVISQEAENFLLDAV 162 +FTPKCP LTIVRCN RGYCKPV AV GGPKF+S SV SQEAENFLLDAV Sbjct: 47 EFTPKCPCLTIVRCNKRGYCKPVSAVFGGPKFTSDSV-SQEAENFLLDAV 95
BLAST of GO660540 vs. TrEMBL
Match: C6T0N2_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 3.501e-14 Identity = 39/50 (78.00%), Postives = 42/50 (84.00%), Query Frame = 1 Query: 13 QFTPKCPYLTIVRCNMRGYCKPVFAVLGGPKFSSKSVISQEAENFLLDAV 162 +FTPKCPYLTIVRCNMRGYCKPV AVLGGPKF+SK +NFLLDAV Sbjct: 47 EFTPKCPYLTIVRCNMRGYCKPVAAVLGGPKFTSK------FKNFLLDAV 90
BLAST of GO660540 vs. TrEMBL
Match: B7FGH8_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.798e-10 Identity = 38/49 (77.55%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 16 FTPKCPYLTIVRCNMRGYCKPVFAVLGGPKFSSKSVISQEAENFLLDAV 162 FTPK +T VR NMRGY KPVFAVLGG FSSKS SQEAENFLLDAV Sbjct: 47 FTPKRSTMTTVRSNMRGYHKPVFAVLGGSNFSSKSG-SQEAENFLLDAV 94 The following BLAST results are available for this feature:
BLAST of GO660540 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GO660540 ID=GO660540; Name=GO660540; organism=Cicer arietinum; type=EST; length=176bpback to top |