CD766045
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CD766045 vs. TrEMBL
Match: Q9SA26_ARATH (F3O9.7 protein OS=Arabidopsis thaliana GN=At1g16270 PE=1 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.809e-11 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIPS+CD Sbjct: 1066 LTGEEPYANMHYGAIIGGIVNNTLRPTIPSYCD 1098
BLAST of CD766045 vs. TrEMBL
Match: Q0WN08_ARATH (Putative Ser/Thr protein kinase (Fragment) OS=Arabidopsis thaliana GN=At1g16270 PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.809e-11 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIPS+CD Sbjct: 944 LTGEEPYANMHYGAIIGGIVNNTLRPTIPSYCD 976
BLAST of CD766045 vs. TrEMBL
Match: D7KDP4_ARALY (Kinase family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_471824 PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.809e-11 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIPS+CD Sbjct: 1066 LTGEEPYANMHYGAIIGGIVNNTLRPTIPSYCD 1098
BLAST of CD766045 vs. TrEMBL
Match: B9HGT5_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_218265 PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.809e-11 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIPS+CD Sbjct: 211 LTGEEPYANMHYGAIIGGIVNNTLRPTIPSYCD 243
BLAST of CD766045 vs. TrEMBL
Match: B9H610_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_208021 PE=4 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.809e-11 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIPS+CD Sbjct: 220 LTGEEPYANMHYGAIIGGIVNNTLRPTIPSYCD 252
BLAST of CD766045 vs. TrEMBL
Match: B9RHZ4_RICCO (Serine/threonine protein kinase, putative OS=Ricinus communis GN=RCOM_1574680 PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.669e-11 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIPS+CD Sbjct: 1161 LTGEEPYANMHYGAIIGGIVNNTLRPTIPSNCD 1193
BLAST of CD766045 vs. TrEMBL
Match: O64768_ARATH (Putative uncharacterized protein At2g35050 OS=Arabidopsis thaliana GN=At2g35050 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.174e-11 Identity = 29/33 (87.88%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPT+P++CD Sbjct: 1176 LTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCD 1208
BLAST of CD766045 vs. TrEMBL
Match: D7LHR9_ARALY (Kinase family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_482471 PE=4 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.174e-11 Identity = 29/33 (87.88%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPT+P++CD Sbjct: 1173 LTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCD 1205
BLAST of CD766045 vs. TrEMBL
Match: Q9SAJ2_ARATH (T8K14.1 protein OS=Arabidopsis thaliana GN=At1g79570 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.821e-10 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIP CD Sbjct: 1167 LTGEEPYANMHYGAIIGGIVNNTLRPTIPGFCD 1199
BLAST of CD766045 vs. TrEMBL
Match: Q56WL1_ARATH (Putative uncharacterized protein At1g79570 (Fragment) OS=Arabidopsis thaliana GN=At1g79570 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.821e-10 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIP CD Sbjct: 159 LTGEEPYANMHYGAIIGGIVNNTLRPTIPGFCD 191
BLAST of CD766045 vs. TAIR peptide
Match: AT1G16270.2 (| Symbols: | Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain | chr1:5563890-5568145 FORWARD LENGTH=1147) HSP 1 Score: 71.633 bits (174), Expect = 1.098e-13 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIPS+CD Sbjct: 1066 LTGEEPYANMHYGAIIGGIVNNTLRPTIPSYCD 1098
BLAST of CD766045 vs. TAIR peptide
Match: AT1G16270.1 (| Symbols: | Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain | chr1:5563890-5568145 FORWARD LENGTH=1147) HSP 1 Score: 71.633 bits (174), Expect = 1.098e-13 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIPS+CD Sbjct: 1066 LTGEEPYANMHYGAIIGGIVNNTLRPTIPSYCD 1098
BLAST of CD766045 vs. TAIR peptide
Match: AT2G35050.1 (| Symbols: | Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain | chr2:14769708-14774796 FORWARD LENGTH=1257) HSP 1 Score: 70.0922 bits (170), Expect = 3.195e-13 Identity = 29/33 (87.88%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPT+P++CD Sbjct: 1176 LTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCD 1208
BLAST of CD766045 vs. TAIR peptide
Match: AT1G79570.1 (| Symbols: | Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain | chr1:29932856-29937540 REVERSE LENGTH=1248) HSP 1 Score: 68.9366 bits (167), Expect = 7.117e-13 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYANMHYGAIIGGIVNNTLRPTIP CD Sbjct: 1167 LTGEEPYANMHYGAIIGGIVNNTLRPTIPGFCD 1199
BLAST of CD766045 vs. TAIR peptide
Match: AT3G46920.1 (| Symbols: | Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain | chr3:17280430-17284857 REVERSE LENGTH=1171) HSP 1 Score: 62.003 bits (149), Expect = 8.700e-11 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 16 TGEEPYANMHYGAIIGGIVNNTLRPTIPSHCDL 114 TGEEPYA++HYGAIIGGIV+NTLRP IP CD+ Sbjct: 1092 TGEEPYADLHYGAIIGGIVSNTLRPQIPDFCDM 1124
BLAST of CD766045 vs. TAIR peptide
Match: AT1G04700.1 (| Symbols: | PB1 domain-containing protein tyrosine kinase | chr1:1316919-1320653 FORWARD LENGTH=1042) HSP 1 Score: 60.4622 bits (145), Expect = 2.531e-10 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYAN+H GAIIGGIVNNTLRP +P C+ Sbjct: 969 LTGEEPYANLHCGAIIGGIVNNTLRPPVPERCE 1001
BLAST of CD766045 vs. TAIR peptide
Match: AT3G24715.1 (| Symbols: | Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain | chr3:9025849-9029948 FORWARD LENGTH=1117) HSP 1 Score: 56.6102 bits (135), Expect = 3.655e-9 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHC 108 +TGEEPYA+MH GAIIGGIV NTLRP IP C Sbjct: 1039 LTGEEPYADMHCGAIIGGIVKNTLRPPIPKSC 1070
BLAST of CD766045 vs. TAIR peptide
Match: AT5G57610.1 (| Symbols: | Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain | chr5:23325307-23329099 FORWARD LENGTH=1054) HSP 1 Score: 55.4546 bits (132), Expect = 8.143e-9 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = 1 Query: 13 VTGEEPYANMHYGAIIGGIVNNTLRPTIPSHCD 111 +TGEEPYA+MH +IIGGIVNN LRP IP CD Sbjct: 984 LTGEEPYADMHCASIIGGIVNNALRPKIPQWCD 1016 The following BLAST results are available for this feature:
BLAST of CD766045 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of CD766045 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 8
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CD766045 ID=CD766045; Name=CD766045; organism=Cicer arietinum; type=EST; length=127bpback to top |