GH720784
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GH720784 vs. TrEMBL
Match: Q41064_PEA (Thiolprotease OS=Pisum sativum GN=tpp PE=2 SV=2) HSP 1 Score: 63.5438 bits (153), Expect = 7.723e-9 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = -2 Query: 23 VSLALDMSIISYDKTHPDKSTPRTNDQMLTMY 118 +SLALDM IISYDKTHPDKSTPRTNDQ+LTMY Sbjct: 16 LSLALDMCIISYDKTHPDKSTPRTNDQVLTMY 47
BLAST of GH720784 vs. TrEMBL
Match: B7FH81_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.535e-7 Identity = 29/30 (96.67%), Postives = 29/30 (96.67%), Query Frame = 1 Query: 208 MAP-KERAPRVSRNPDLIRGIGKFSKSQMY 294 MAP KERAPRVSRNPDLIRGIGKFSKSQMY Sbjct: 1 MAPTKERAPRVSRNPDLIRGIGKFSKSQMY 30
BLAST of GH720784 vs. TAIR peptide
Match: AT1G74050.1 (| Symbols: | Ribosomal protein L6 family protein | chr1:27847256-27848680 REVERSE LENGTH=233) HSP 1 Score: 49.2914 bits (116), Expect = 5.757e-7 Identity = 20/29 (68.97%), Postives = 26/29 (89.66%), Query Frame = 1 Query: 208 MAPKERAPRVSRNPDLIRGIGKFSKSQMY 294 M K+R P+V+RNPDLIRG+GK+S+SQMY Sbjct: 1 MPAKQRTPKVNRNPDLIRGVGKYSRSQMY 29 The following BLAST results are available for this feature:
BLAST of GH720784 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of GH720784 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GH720784 ID=GH720784; Name=GH720784; organism=Pisum sativum; type=EST; length=311bpback to top |