CD859507

EST Overview
NameCD859507
Unique NameCD859507
TypeEST
OrganismPisum sativum (pea)
Sequence length149
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide2011-02-03
Libraries
Library NameType
LIBEST_014000 F15cdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD859507 vs. TrEMBL
Match: A4ZGT8_SOYBN (Transcription factor bZIP63 (Fragment) OS=Glycine max GN=bZIP63 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.261e-16
Identity = 45/49 (91.84%), Postives = 49/49 (100.00%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +LQAEGSEVSAELEFLNQQNLILSMENKALKQRLE++A+EQLIKYLEQE
Sbjct:   97 ALQAEGSEVSAELEFLNQQNLILSMENKALKQRLENIAQEQLIKYLEQE 145          
BLAST of CD859507 vs. TrEMBL
Match: A5B6S2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_021778 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.857e-16
Identity = 45/49 (91.84%), Postives = 49/49 (100.00%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +L+AEGSEVSAEL+FLNQQNLILSMENKALKQRLESLA+EQLIKYLEQE
Sbjct:  259 ALKAEGSEVSAELDFLNQQNLILSMENKALKQRLESLAQEQLIKYLEQE 307          
BLAST of CD859507 vs. TrEMBL
Match: B9T452_RICCO (Transcription factor RF2a, putative OS=Ricinus communis GN=RCOM_0290330 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.122e-15
Identity = 44/49 (89.80%), Postives = 48/49 (97.96%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +LQAEGSEVSAE+EFLNQQNLIL+MENKALKQRLESLA+EQLIKYLE E
Sbjct:  265 ALQAEGSEVSAEVEFLNQQNLILNMENKALKQRLESLAQEQLIKYLEHE 313          
BLAST of CD859507 vs. TrEMBL
Match: A9PHN3_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.122e-15
Identity = 44/49 (89.80%), Postives = 48/49 (97.96%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +LQAEGSEVSAELEF+NQQNLILSMENKALKQRLE+LA+EQLIKYLE E
Sbjct:  261 ALQAEGSEVSAELEFVNQQNLILSMENKALKQRLENLAQEQLIKYLEHE 309          
BLAST of CD859507 vs. TrEMBL
Match: B9GZ55_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_553391 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.499e-15
Identity = 42/47 (89.36%), Postives = 46/47 (97.87%), Query Frame = -3
Query:    1 QAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 141
            +AEGSEVSAELEF+NQQNLILSMENKALKQRLE+LA+EQLIKYLE E
Sbjct:  275 EAEGSEVSAELEFVNQQNLILSMENKALKQRLENLAQEQLIKYLEHE 321          
BLAST of CD859507 vs. TrEMBL
Match: D7KY87_ARALY (Predicted protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_675532 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.050e-13
Identity = 40/49 (81.63%), Postives = 48/49 (97.96%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +LQAEGS+VSAEL+FLNQ+NLILSMENKALKQRLE++A+E+LIK LEQE
Sbjct:  261 TLQAEGSKVSAELDFLNQRNLILSMENKALKQRLETIAQEKLIKQLEQE 309          
BLAST of CD859507 vs. TrEMBL
Match: Q84WC8_ARATH (At1g58110 OS=Arabidopsis thaliana GN=At1g58110 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.372e-13
Identity = 40/49 (81.63%), Postives = 48/49 (97.96%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +LQAEGS+VSAEL+FLNQ+NLILSMENKALK+RLES+A+E+LIK LEQE
Sbjct:  263 TLQAEGSKVSAELDFLNQRNLILSMENKALKKRLESIAQEKLIKQLEQE 311          
BLAST of CD859507 vs. TrEMBL
Match: B9N898_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_584476 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.372e-13
Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +LQA+GSEVSAELEF+NQQNLILSMENKALKQR E+LA EQLIK LE E
Sbjct:  260 ALQAKGSEVSAELEFVNQQNLILSMENKALKQRFENLAHEQLIKCLEHE 308          
BLAST of CD859507 vs. TrEMBL
Match: Q3LVL8_TAROF (TO56-2 (Fragment) OS=Taraxacum officinale GN=To56-2 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.830e-12
Identity = 37/43 (86.05%), Postives = 42/43 (97.67%), Query Frame = -3
Query:   19 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLI 147
            +LQAEGSEVSAE+EFLNQQ++IL MENKALKQRLESLA+EQLI
Sbjct:   17 ALQAEGSEVSAEVEFLNQQSIILGMENKALKQRLESLAQEQLI 59          
BLAST of CD859507 vs. TrEMBL
Match: Q9C537_ARATH (BZIP transcriptional activator RSG, putative OS=Arabidopsis thaliana GN=T18I24.3 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.677e-11
Identity = 36/44 (81.82%), Postives = 44/44 (100.00%), Query Frame = -3
Query:   16 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIK 147
            +LQAEGS+VSAEL+FLNQ+NLILSMENKALK+RLES+A+E+LIK
Sbjct:  263 TLQAEGSKVSAELDFLNQRNLILSMENKALKKRLESIAQEKLIK 306          
BLAST of CD859507 vs. TAIR peptide
Match: AT1G58110.2 (| Symbols: | Basic-leucine zipper (bZIP) transcription factor family protein | chr1:21515919-21517374 REVERSE LENGTH=374)

HSP 1 Score: 79.337 bits (194), Expect = 5.172e-16
Identity = 40/49 (81.63%), Postives = 48/49 (97.96%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +LQAEGS+VSAEL+FLNQ+NLILSMENKALK+RLES+A+E+LIK LEQE
Sbjct:  263 TLQAEGSKVSAELDFLNQRNLILSMENKALKKRLESIAQEKLIKQLEQE 311          
BLAST of CD859507 vs. TAIR peptide
Match: AT1G58110.1 (| Symbols: | Basic-leucine zipper (bZIP) transcription factor family protein | chr1:21515919-21517374 REVERSE LENGTH=374)

HSP 1 Score: 79.337 bits (194), Expect = 5.172e-16
Identity = 40/49 (81.63%), Postives = 48/49 (97.96%), Query Frame = -3
Query:    1 SLQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 147
            +LQAEGS+VSAEL+FLNQ+NLILSMENKALK+RLES+A+E+LIK LEQE
Sbjct:  263 TLQAEGSKVSAELDFLNQRNLILSMENKALKKRLESIAQEKLIKQLEQE 311          
BLAST of CD859507 vs. TAIR peptide
Match: AT1G35490.1 (| Symbols: | bZIP family transcription factor | chr1:13061856-13063166 FORWARD LENGTH=300)

HSP 1 Score: 57.7658 bits (138), Expect = 1.612e-9
Identity = 27/48 (56.25%), Postives = 40/48 (83.33%), Query Frame = -3
Query:    1 LQAEGSEVSAELEFLNQQNLILSMENKALKQRLESLAREQLIKYLEQE 144
            LQ EG E+S+ + +L+QQ L+LSMEN+ALKQR++SLA  Q +K++EQ+
Sbjct:  201 LQVEGCEMSSAIHYLDQQLLMLSMENRALKQRMDSLAEIQKLKHVEQQ 248          
The following BLAST results are available for this feature:
BLAST of CD859507 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
A4ZGT8_SOYBN2.261e-1691.84Transcription factor bZIP63 (Fragment) OS=Glycine ... [more]
A5B6S2_VITVI3.857e-1691.84Putative uncharacterized protein OS=Vitis vinifera... [more]
B9T452_RICCO1.122e-1589.80Transcription factor RF2a, putative OS=Ricinus com... [more]
A9PHN3_POPTR1.122e-1589.80Putative uncharacterized protein OS=Populus tricho... [more]
B9GZ55_POPTR9.499e-1589.36Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7KY87_ARALY1.050e-1381.63Predicted protein OS=Arabidopsis lyrata subsp. lyr... [more]
Q84WC8_ARATH1.372e-1381.63At1g58110 OS=Arabidopsis thaliana GN=At1g58110 PE=... [more]
B9N898_POPTR1.372e-1383.67Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q3LVL8_TAROF9.830e-1286.05TO56-2 (Fragment) OS=Taraxacum officinale GN=To56-... [more]
Q9C537_ARATH1.677e-1181.82BZIP transcriptional activator RSG, putative OS=Ar... [more]
back to top
BLAST of CD859507 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT1G58110.25.172e-1681.63| Symbols: | Basic-leucine zipper (bZIP) transcri... [more]
AT1G58110.15.172e-1681.63| Symbols: | Basic-leucine zipper (bZIP) transcri... [more]
AT1G35490.11.612e-956.25| Symbols: | bZIP family transcription factor | c... [more]
back to top
Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD859507 ID=CD859507|Name=CD859507|organism=Pisum sativum|type=EST|length=149bp
TTCCTGCTCCAAGTATTTGATAAGCTGCTCCCGTGCTAAACTTTCTAAAC
GCTGTTTGAGTGCTTTATTCTCCATACTCAGGATAAGATTCTGCTGGTTA
AGAAACTCAAGCTCAGCTGATACTTCAGACCCTTCTGCCTGTAAAGACT
back to top