CD858903

EST Overview
NameCD858903
Unique NameCD858903
TypeEST
OrganismPisum sativum (pea)
Sequence length451
Libraries
Library NameType
LIBEST_013997 CIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858903 vs. TrEMBL
Match: Q8W1A1_SOYBN (Adenosine 5'-phosphosulfate reductase OS=Glycine max PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 6.614e-61
Identity = 111/138 (80.43%), Postives = 121/138 (87.68%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG GSLVKWNPV NVNG+DIW+FLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQ+EREGRWWWEDAKAKECGLHKGN+K +DAAQ             S TVADIFNS++VVSLSR+GIENLAKL++RKEPW
Sbjct:  246 FEGLDGGIGSLVKWNPVANVNGLDIWSFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKHEDAAQ--LNGNGASQANGSATVADIFNSQDVVSLSRSGIENLAKLENRKEPW 381          
BLAST of CD858903 vs. TrEMBL
Match: Q6V3B0_9ROSI (Adenosine 5' phosphosulfate reductase OS=Populus tremula x Populus alba PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.056e-58
Identity = 104/138 (75.36%), Postives = 116/138 (84.06%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG+GSL+KWNP+ NV G D+W FLRTMDVPVNSLHS+GY+SIGCEPCTRPVLPGQ+EREGRWWWEDA AKECGLHKGNLKQ DAAQ             + TVADIFNSEN+V+LSR GIENL KL++RKEPW
Sbjct:  239 FEGLDGGAGSLIKWNPMANVEGQDVWKFLRTMDVPVNSLHSKGYISIGCEPCTRPVLPGQHEREGRWWWEDATAKECGLHKGNLKQGDAAQLNGNGNGAAHANGAATVADIFNSENLVNLSRPGIENLLKLENRKEPW 376          
BLAST of CD858903 vs. TrEMBL
Match: B9NBS8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_588813 PE=4 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.056e-58
Identity = 104/138 (75.36%), Postives = 116/138 (84.06%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG+GSL+KWNP+ NV G D+W FLRTMDVPVNSLHS+GY+SIGCEPCTRPVLPGQ+EREGRWWWEDA AKECGLHKGNLKQ DAAQ             + TVADIFNSEN+V+LSR GIENL KL++RKEPW
Sbjct:   45 FEGLDGGAGSLIKWNPMANVEGQDVWKFLRTMDVPVNSLHSKGYISIGCEPCTRPVLPGQHEREGRWWWEDATAKECGLHKGNLKQGDAAQLNGNGNGAAHANGAATVADIFNSENLVNLSRPGIENLLKLENRKEPW 182          
BLAST of CD858903 vs. TrEMBL
Match: A9PEF8_POPTR (Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 4.013e-58
Identity = 103/138 (74.64%), Postives = 115/138 (83.33%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG+GSL+KWNP+ NV G D+W FLRTMDVPVNSLHS+GY+SIGCEPCTRPVLPGQ+EREGRWWWEDA AKECGLHKGNLKQ D AQ             + TVADIFNSEN+V+LSR GIENL KL++RKEPW
Sbjct:  239 FEGLDGGAGSLIKWNPMANVEGQDVWKFLRTMDVPVNSLHSKGYISIGCEPCTRPVLPGQHEREGRWWWEDATAKECGLHKGNLKQGDEAQLNGNGNGAAHANGAATVADIFNSENLVNLSRPGIENLLKLENRKEPW 376          
BLAST of CD858903 vs. TrEMBL
Match: B9RXK0_RICCO (5'-adenylylsulfate reductase 1, chloroplast, putative OS=Ricinus communis GN=RCOM_0904170 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 4.436e-57
Identity = 99/138 (71.74%), Postives = 115/138 (83.33%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG+GSL+KWNP+ NV+G D+W FLR M+VPVNSLH+QGY+SIGCEPCT+PVLPGQ+EREGRWWWEDA+AKECGLHKGNLKQDD AQ             S  VADIFNS+++V LSR GIENL KL++RKEPW
Sbjct:  245 FEGLDGGAGSLIKWNPMANVDGEDVWKFLRAMEVPVNSLHAQGYISIGCEPCTKPVLPGQHEREGRWWWEDARAKECGLHKGNLKQDDVAQHNGNGNGAAHSNGSAAVADIFNSQSLVKLSRTGIENLLKLENRKEPW 382          
BLAST of CD858903 vs. TrEMBL
Match: Q5EUC8_MAIZE (Adenosine 5'-phosphosulfate reductase 2 OS=Zea mays GN=APRL2 PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 7.831e-54
Identity = 98/138 (71.01%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG+GSLVKWNPV NV+G DIWTFLRTMDVPVN+LH+QGYVSIGCEPCTRPVLPGQ+EREGRWWWEDAKAKECGLHKGN+ +D  A              S    DIF S  VVSL+RAG+ENL +L+ R EPW
Sbjct:  239 FEGLDGGAGSLVKWNPVANVDGKDIWTFLRTMDVPVNALHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIDKDGQAAAAAAAPRTANGNGSAGAPDIFESPAVVSLTRAGVENLLRLESRAEPW 376          
BLAST of CD858903 vs. TrEMBL
Match: Q672Q8_SOLLC (Adenylyl-sulfate reductase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.336e-53
Identity = 99/141 (70.21%), Postives = 116/141 (82.27%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQD---DAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG+GSLVKWNPV NV+G DIW FLR M+VPVNSLHSQGYVSIGCEPCTRPVLPGQ+EREGRWWWEDAKAKECGLHKGN+K +    AAQ             + TVADIF+++++V+LS+ G+ENL KL+DR+EPW
Sbjct:  242 FEGLDGGAGSLVKWNPVANVDGKDIWNFLRAMNVPVNSLHSQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKDETVNGAAQ----------TNGTATVADIFDTKDIVTLSKPGVENLVKLEDRREPW 372          
BLAST of CD858903 vs. TrEMBL
Match: Q9ZP22_BRAJU (APS reductase OS=Brassica juncea GN=apsr8 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.745e-53
Identity = 100/138 (72.46%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG+GSLVKWNPV NV G D+W FLRTMDVPVN+LH+ GYVSIGCEPCTR VLPGQ+EREGRWWWEDAKAKECGLHKGN+K+                  S TVADIF SENVVSLSR GIENL KL++RKE W
Sbjct:  243 FEGLDGGAGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYVSIGCEPCTRAVLPGQHEREGRWWWEDAKAKECGLHKGNIKESSNGN-----ATANVNGTSSTVADIFKSENVVSLSRQGIENLMKLENRKEAW 375          
BLAST of CD858903 vs. TrEMBL
Match: D7TE87_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_59.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00030440001 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.745e-53
Identity = 95/138 (68.84%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEG+D G GSLVKWNPV NV+ +DIW FLR M+VPVNSLHSQGYVSIGCEPCTRPVLPGQ+EREGRWWWED+KAKECGLHKGN+KQ+   +             +  V DIFNS+NVVSLSR GI NL KL++R +PW
Sbjct:  241 FEGMDSGVGSLVKWNPVANVDSMDIWNFLRAMNVPVNSLHSQGYVSIGCEPCTRPVLPGQHEREGRWWWEDSKAKECGLHKGNIKQEQVPELNGNGNGAAHKNGNAAVTDIFNSQNVVSLSRTGIGNLTKLENRADPW 378          
BLAST of CD858903 vs. TrEMBL
Match: Q8L6B6_SOLTU (APS reductase (Fragment) OS=Solanum tuberosum GN=apsr1 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.278e-53
Identity = 95/138 (68.84%), Postives = 113/138 (81.88%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG+GSLVKWNPV NV+G DIW FLR M+VPVNSLHSQGYVSIGCEPCTRPVLPGQ+EREGRWWWEDAKAKECGLHKGN+K +                 + T+ADIF+++++V+LS+ G+ENL KL+DR+EPW
Sbjct:  122 FEGLDGGAGSLVKWNPVANVDGKDIWNFLRAMNVPVNSLHSQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKDESV-------DGAVQTNGTATIADIFDTKDIVTLSKPGVENLLKLEDRREPW 252          
BLAST of CD858903 vs. SwissProt
Match: APR3_ARATH (5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana GN=APR3 PE=2 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 6.871e-54
Identity = 98/138 (71.01%), Postives = 110/138 (79.71%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG GSLVKWNPV NV G D+W FLRTMDVPVN+LH+ GYVSIGCEPCTR VLPGQ+EREGRWWWEDAKAKECGLHKGN+K++                 + +VADIFNSENVV+LSR GIENL KL++RKE W
Sbjct:  238 FEGLDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYVSIGCEPCTRAVLPGQHEREGRWWWEDAKAKECGLHKGNIKENTNGN------ATANVNGTASVADIFNSENVVNLSRQGIENLMKLENRKEAW 369          
BLAST of CD858903 vs. SwissProt
Match: APR2_ARATH (5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana GN=APR2 PE=2 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 6.871e-54
Identity = 95/138 (68.84%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG GSLVKWNP+ NV G D+W FLRTMDVPVN+LH+QGYVSIGCEPCTRPVLPGQ+EREGRWWWEDAKAKECGLHKGN+K++D A                 V +IF S NVV+LS+ G+ENL KL++RKE W
Sbjct:  238 FEGLDGGVGSLVKWNPLANVEGADVWNFLRTMDVPVNALHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKEEDGA----------ADSKPAAVQEIFESNNVVALSKGGVENLLKLENRKEAW 365          
BLAST of CD858903 vs. SwissProt
Match: APR1_ARATH (5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2)

HSP 1 Score: 207.223 bits (526), Expect = 2.611e-53
Identity = 98/140 (70.00%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQ--DDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG GSLVKWNPV NV G D+W FLRTMDVPVN+LH+ GY+SIGCEPCT+ VLPGQ+EREGRWWWEDAKAKECGLHKGN+K+  DDA                  VADIF SEN+V+LSR GIENL KL++RKEPW
Sbjct:  246 FEGLDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYISIGCEPCTKAVLPGQHEREGRWWWEDAKAKECGLHKGNVKENSDDA---------KVNGESKSAVADIFKSENLVTLSRQGIENLMKLENRKEPW 376          
BLAST of CD858903 vs. SwissProt
Match: CYSH_PSEAE (Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa GN=cysH PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 9.351e-27
Identity = 46/74 (62.16%), Postives = 62/74 (83.78%), Query Frame = 1
Query:   67 LVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNL 288
            L K+NP++++   ++W ++R +++P NSLH +GY+SIGCEPCTRPVLP Q+EREGRWWWE+A  KECGLH GNL
Sbjct:  190 LYKFNPLSSMTSEEVWGYIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWEEATHKECGLHAGNL 263          
BLAST of CD858903 vs. SwissProt
Match: CYSH_PSEAB (Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysH PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 9.351e-27
Identity = 46/74 (62.16%), Postives = 62/74 (83.78%), Query Frame = 1
Query:   67 LVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNL 288
            L K+NP++++   ++W ++R +++P NSLH +GY+SIGCEPCTRPVLP Q+EREGRWWWE+A  KECGLH GNL
Sbjct:  190 LYKFNPLSSMTSEEVWGYIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWEEATHKECGLHAGNL 263          
BLAST of CD858903 vs. SwissProt
Match: CYSH_PSEA8 (Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysH PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 9.351e-27
Identity = 46/74 (62.16%), Postives = 62/74 (83.78%), Query Frame = 1
Query:   67 LVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNL 288
            L K+NP++++   ++W ++R +++P NSLH +GY+SIGCEPCTRPVLP Q+EREGRWWWE+A  KECGLH GNL
Sbjct:  190 LYKFNPLSSMTSEEVWGYIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWEEATHKECGLHAGNL 263          
BLAST of CD858903 vs. SwissProt
Match: CYSH_NEIMA (Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup A GN=cysH PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.231e-20
Identity = 41/81 (50.62%), Postives = 56/81 (69.14%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHK 279
            F   D G G + K+NP+ + +  D+W ++   +VP N L+ QG+ SIGC+PCTRPV  G++ R GRWWWED  +KECGLHK
Sbjct:  165 FAEYDAGRG-IDKYNPIFDWSEHDVWAYILANNVPYNDLYRQGFPSIGCDPCTRPVKAGEDIRAGRWWWEDKNSKECGLHK 244          
BLAST of CD858903 vs. SwissProt
Match: CYSH_NEIMB (Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup B GN=cysH1 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.446e-19
Identity = 40/81 (49.38%), Postives = 55/81 (67.90%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHK 279
            F   D G G + K+NP+ + +  D+W ++   +VP N L+ QG+ SIGC+PCTRPV  G++ R GRWWWE   +KECGLHK
Sbjct:  167 FAEYDAGRG-IGKYNPIFDWSEHDVWAYILANNVPYNDLYRQGFPSIGCDPCTRPVKAGEDIRAGRWWWEGRNSKECGLHK 246          
BLAST of CD858903 vs. SwissProt
Match: CYSH_RHIME (Phosphoadenosine phosphosulfate reductase OS=Rhizobium meliloti GN=cysH PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.308e-17
Identity = 37/70 (52.86%), Postives = 48/70 (68.57%), Query Frame = 1
Query:   67 LVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLH 276
            L+K NP+ +     I   +    +PVN LHS+GY SIGCEPCTR + PG+ ER GRWWWE+ + +ECGLH
Sbjct:  180 LIKINPLADWGIETIQAHVAAEGIPVNPLHSRGYPSIGCEPCTRAIKPGEPERAGRWWWENDEKRECGLH 249          
BLAST of CD858903 vs. SwissProt
Match: CYSH_RHITR (Phosphoadenosine phosphosulfate reductase (Fragment) OS=Rhizobium tropici GN=cysH PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.015e-17
Identity = 37/71 (52.11%), Postives = 50/71 (70.42%), Query Frame = 1
Query:   64 SLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLH 276
            +L+K NP+ + +   I  ++    VPVN LH +GY SIGCEPCTR + PG+ ER GRWWWE+ + +ECGLH
Sbjct:  101 NLIKVNPLADWDIDVIRAYVADNGVPVNPLHQRGYPSIGCEPCTRAIKPGEPERAGRWWWENDEKRECGLH 171          
BLAST of CD858903 vs. TAIR peptide
Match: AT4G21990.1 (| Symbols: APR3, PRH-26, PRH26, ATAPR3 | APS reductase 3 | chr4:11657284-11658973 REVERSE LENGTH=458)

HSP 1 Score: 209.149 bits (531), Expect = 8.092e-55
Identity = 98/138 (71.01%), Postives = 110/138 (79.71%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG GSLVKWNPV NV G D+W FLRTMDVPVN+LH+ GYVSIGCEPCTR VLPGQ+EREGRWWWEDAKAKECGLHKGN+K++                 + +VADIFNSENVV+LSR GIENL KL++RKE W
Sbjct:  238 FEGLDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYVSIGCEPCTRAVLPGQHEREGRWWWEDAKAKECGLHKGNIKENTNGN------ATANVNGTASVADIFNSENVVNLSRQGIENLMKLENRKEAW 369          
BLAST of CD858903 vs. TAIR peptide
Match: AT1G62180.2 (| Symbols: APR2 | 5'adenylylphosphosulfate reductase 2 | chr1:22975794-22977465 REVERSE LENGTH=447)

HSP 1 Score: 209.149 bits (531), Expect = 8.092e-55
Identity = 95/138 (68.84%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG GSLVKWNP+ NV G D+W FLRTMDVPVN+LH+QGYVSIGCEPCTRPVLPGQ+EREGRWWWEDAKAKECGLHKGN+K++D A                 V +IF S NVV+LS+ G+ENL KL++RKE W
Sbjct:  231 FEGLDGGVGSLVKWNPLANVEGADVWNFLRTMDVPVNALHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKEEDGA----------ADSKPAAVQEIFESNNVVALSKGGVENLLKLENRKEAW 358          
BLAST of CD858903 vs. TAIR peptide
Match: AT1G62180.1 (| Symbols: APR2, APSR, PRH43, PRH, ATAPR2 | 5'adenylylphosphosulfate reductase 2 | chr1:22975794-22977465 REVERSE LENGTH=454)

HSP 1 Score: 209.149 bits (531), Expect = 8.092e-55
Identity = 95/138 (68.84%), Postives = 109/138 (78.99%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQDDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG GSLVKWNP+ NV G D+W FLRTMDVPVN+LH+QGYVSIGCEPCTRPVLPGQ+EREGRWWWEDAKAKECGLHKGN+K++D A                 V +IF S NVV+LS+ G+ENL KL++RKE W
Sbjct:  238 FEGLDGGVGSLVKWNPLANVEGADVWNFLRTMDVPVNALHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKEEDGA----------ADSKPAAVQEIFESNNVVALSKGGVENLLKLENRKEAW 365          
BLAST of CD858903 vs. TAIR peptide
Match: AT4G04610.1 (| Symbols: APR1, APR, PRH19, ATAPR1 | APS reductase 1 | chr4:2325069-2326718 FORWARD LENGTH=465)

HSP 1 Score: 207.223 bits (526), Expect = 3.075e-54
Identity = 98/140 (70.00%), Postives = 110/140 (78.57%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRWWWEDAKAKECGLHKGNLKQ--DDAAQXXXXXXXXXXXXXSPTVADIFNSENVVSLSRAGIENLAKLQDRKEPW 450
            FEGLDGG GSLVKWNPV NV G D+W FLRTMDVPVN+LH+ GY+SIGCEPCT+ VLPGQ+EREGRWWWEDAKAKECGLHKGN+K+  DDA                  VADIF SEN+V+LSR GIENL KL++RKEPW
Sbjct:  246 FEGLDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYISIGCEPCTKAVLPGQHEREGRWWWEDAKAKECGLHKGNVKENSDDA---------KVNGESKSAVADIFKSENLVTLSRQGIENLMKLENRKEPW 376          
BLAST of CD858903 vs. TAIR peptide
Match: AT4G21990.2 (| Symbols: APR3 | APS reductase 3 | chr4:11657591-11659147 REVERSE LENGTH=340)

HSP 1 Score: 127.872 bits (320), Expect = 2.371e-30
Identity = 56/67 (83.58%), Postives = 60/67 (89.55%), Query Frame = 1
Query:   37 FEGLDGGSGSLVKWNPVTNVNGIDIWTFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQNEREGRW 237
            FEGLDGG GSLVKWNPV NV G D+W FLRTMDVPVN+LH+ GYVSIGCEPCTR VLPGQ+EREGRW
Sbjct:  273 FEGLDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYVSIGCEPCTRAVLPGQHEREGRW 339          
The following BLAST results are available for this feature:
BLAST of CD858903 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q8W1A1_SOYBN6.614e-6180.43Adenosine 5'-phosphosulfate reductase OS=Glycine m... [more]
Q6V3B0_9ROSI1.056e-5875.36Adenosine 5' phosphosulfate reductase OS=Populus t... [more]
B9NBS8_POPTR1.056e-5875.36Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A9PEF8_POPTR4.013e-5874.64Putative uncharacterized protein OS=Populus tricho... [more]
B9RXK0_RICCO4.436e-5771.745'-adenylylsulfate reductase 1, chloroplast, putat... [more]
Q5EUC8_MAIZE7.831e-5471.01Adenosine 5'-phosphosulfate reductase 2 OS=Zea may... [more]
Q672Q8_SOLLC1.336e-5370.21Adenylyl-sulfate reductase OS=Solanum lycopersicum... [more]
Q9ZP22_BRAJU1.745e-5372.46APS reductase OS=Brassica juncea GN=apsr8 PE=2 SV=... [more]
D7TE87_VITVI1.745e-5368.84Whole genome shotgun sequence of line PN40024, sca... [more]
Q8L6B6_SOLTU2.278e-5368.84APS reductase (Fragment) OS=Solanum tuberosum GN=a... [more]
back to top
BLAST of CD858903 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
APR3_ARATH6.871e-5471.015'-adenylylsulfate reductase 3, chloroplastic OS=A... [more]
APR2_ARATH6.871e-5468.845'-adenylylsulfate reductase 2, chloroplastic OS=A... [more]
APR1_ARATH2.611e-5370.005'-adenylylsulfate reductase 1, chloroplastic OS=A... [more]
CYSH_PSEAE9.351e-2762.16Phosphoadenosine phosphosulfate reductase OS=Pseud... [more]
CYSH_PSEAB9.351e-2762.16Phosphoadenosine phosphosulfate reductase OS=Pseud... [more]
CYSH_PSEA89.351e-2762.16Phosphoadenosine phosphosulfate reductase OS=Pseud... [more]
CYSH_NEIMA2.231e-2050.62Phosphoadenosine phosphosulfate reductase OS=Neiss... [more]
CYSH_NEIMB1.446e-1949.38Phosphoadenosine phosphosulfate reductase OS=Neiss... [more]
CYSH_RHIME2.308e-1752.86Phosphoadenosine phosphosulfate reductase OS=Rhizo... [more]
CYSH_RHITR3.015e-1752.11Phosphoadenosine phosphosulfate reductase (Fragmen... [more]
back to top
BLAST of CD858903 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 5
Match NameE-valueIdentityDescription
AT4G21990.18.092e-5571.01| Symbols: APR3, PRH-26, PRH26, ATAPR3 | APS reduc... [more]
AT1G62180.28.092e-5568.84| Symbols: APR2 | 5'adenylylphosphosulfate reducta... [more]
AT1G62180.18.092e-5568.84| Symbols: APR2, APSR, PRH43, PRH, ATAPR2 | 5'aden... [more]
AT4G04610.13.075e-5470.00| Symbols: APR1, APR, PRH19, ATAPR1 | APS reductas... [more]
AT4G21990.22.371e-3083.58| Symbols: APR3 | APS reductase 3 | chr4:11657591-... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002500Phosphoadenosine phosphosulphate reductasePFAMPF01507PAPS_reductcoord: 14..64
score: 1.2
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3D3.40.50.620no descriptioncoord: 18..60
score: 4.6
NoneNo IPR availableSEGsegsegcoord: 101..113
score
NoneNo IPR availableSUPERFAMILY52402Adenine nucleotide alpha hydrolases-likecoord: 16..63
score: 7.4
NoneNo IPR availableSEGsegsegcoord: 34..41
score
NoneNo IPR availableSEGsegsegcoord: 41..53
score: NAcoord: 68..80
score
NoneNo IPR availableSEGsegsegcoord: 9..25
score: NAcoord: 35..51
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858903 ID=CD858903|Name=CD858903|organism=Pisum sativum|type=EST|length=451bp
TAGGTCTGAAATACTGTTGTTCAAGTTGATCCAGTTTTTGAGGGATTGGA
TGGGGGGAGTGGCAGCCTGGTAAAGTGGAACCCTGTTACTAATGTGAATG
GCATTGACATATGGACCTTCCTAAGAACAATGGACGTGCCTGTTAATTCA
TTGCATTCTCAAGGATATGTTTCCATTGGTTGTGAGCCATGCACAAGGCC
AGTTTTGCCTGGACAGAATGAAAGAGAGGGAAGGTGGTGGTGGGAGGATG
CCAAAGCAAAGGAGTGTGGTCTTCACAAGGGTAATTTGAAACAGGATGAT
GCTGCCCAGAATAATGGTAATGGAAATGGTGTGGGCCATGCAAATGGTTC
TCCCACAGTTGCCGACATTTTCAACTCTGAAAATGTGGTAAGCTTGAGCA
GGGCTGGAATTGAGAATCTGGCCAAATTGCAGGACCGAAAAGAACCCTGG
A
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR002500PAPS_reduct
IPR014729Rossmann-like_a/b/a_fold