AJ308146
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AJ308146 vs. TrEMBL
Match: Q2PP76_MEDTR (Lectin-like protein OS=Medicago truncatula GN=Lec7 PE=2 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.916e-8 Identity = 28/31 (90.32%), Postives = 29/31 (93.55%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPEW RIGFSGATGQLVELHKILSW+F SSF Sbjct: 236 LPEWGRIGFSGATGQLVELHKILSWTFKSSF 266
BLAST of AJ308146 vs. TrEMBL
Match: Q2PP76_MEDTR (Lectin-like protein OS=Medicago truncatula GN=Lec7 PE=2 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 3.646e-8 Identity = 28/31 (90.32%), Postives = 29/31 (93.55%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPEW RIGFSGATGQLVELHKILSW+F SSF Sbjct: 236 LPEWGRIGFSGATGQLVELHKILSWTFKSSF 266
BLAST of AJ308146 vs. Lotus protein
Match: chr2.CM0177.180.r2.m (- phase: 0 /pseudo/partial) HSP 1 Score: 57.7658 bits (138), Expect = 1.122e-9 Identity = 25/30 (83.33%), Postives = 27/30 (90.00%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSS 91 LPEWVR+GFSGATGQLVE HKI SW+F SS Sbjct: 255 LPEWVRVGFSGATGQLVEQHKIFSWNFSSS 284
BLAST of AJ308146 vs. Lotus protein
Match: chr2.CM0177.210.r2.m (- phase: 0 ) HSP 1 Score: 55.0694 bits (131), Expect = 7.272e-9 Identity = 24/31 (77.42%), Postives = 26/31 (83.87%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPEWVR+GFSGATGQLVE H+I W F SSF Sbjct: 234 LPEWVRVGFSGATGQLVEQHRIHVWDFKSSF 264
BLAST of AJ308146 vs. Lotus protein
Match: chr2.CM0177.200.r2.m (- phase: 2 /partial) HSP 1 Score: 53.9138 bits (128), Expect = 1.620e-8 Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPEWVR+GFSGATG LVE H+I +W F SSF Sbjct: 243 LPEWVRVGFSGATGLLVENHRIYAWDFKSSF 273
BLAST of AJ308146 vs. Lotus protein
Match: LjSGA_017217.1 (+ phase: 0 ) HSP 1 Score: 51.2174 bits (121), Expect = 1.050e-7 Identity = 23/30 (76.67%), Postives = 25/30 (83.33%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSS 91 LPEWV +GFSGAT +LVE H ILSWSF SS Sbjct: 173 LPEWVSVGFSGATRRLVEEHNILSWSFSSS 202
BLAST of AJ308146 vs. Lotus protein
Match: LjSGA_016434.1 (+ phase: 0 /partial) HSP 1 Score: 50.0618 bits (118), Expect = 2.339e-7 Identity = 26/44 (59.09%), Postives = 29/44 (65.91%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSFY*YGWL*GNKTSV 133 LPE+VRIGFS ATGQ +ELH I SWSF SS G NK + Sbjct: 227 LPEFVRIGFSAATGQWIELHNIRSWSFNSSLDNNGGGKNNKVEI 270
BLAST of AJ308146 vs. Lotus protein
Match: chr2.CM0177.220.r2.m (- phase: 0 ) HSP 1 Score: 49.6766 bits (117), Expect = 3.055e-7 Identity = 20/27 (74.07%), Postives = 23/27 (85.19%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSF 82 LPEWVR+GFS +TG+LVE H ILSW F Sbjct: 261 LPEWVRVGFSASTGELVETHDILSWGF 287
BLAST of AJ308146 vs. Lotus protein
Match: chr2.CM0177.190.r2.m (- phase: 0 ) HSP 1 Score: 48.1358 bits (113), Expect = 8.890e-7 Identity = 20/27 (74.07%), Postives = 22/27 (81.48%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSF 82 LPEWVR+GFSGATG LVE H I +W F Sbjct: 261 LPEWVRVGFSGATGLLVEQHTIYAWDF 287
BLAST of AJ308146 vs. Soybean peptides
Match: Glyma08g37340.1|PACid:16273058 () HSP 1 Score: 54.6842 bits (130), Expect = 2.174e-8 Identity = 24/29 (82.76%), Postives = 25/29 (86.21%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMS 88 LPEWVRIGFSGATG +VE H ILSWSF S Sbjct: 251 LPEWVRIGFSGATGDMVETHDILSWSFTS 279
BLAST of AJ308146 vs. Soybean peptides
Match: Glyma18g27690.1|PACid:16309368 () HSP 1 Score: 54.299 bits (129), Expect = 2.840e-8 Identity = 22/27 (81.48%), Postives = 25/27 (92.59%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSF 82 LPEWV +GFSGATGQLVE+HKI SW+F Sbjct: 234 LPEWVTVGFSGATGQLVEIHKIFSWTF 260
BLAST of AJ308146 vs. Soybean peptides
Match: Glyma08g37320.1|PACid:16273056 () HSP 1 Score: 53.9138 bits (128), Expect = 3.708e-8 Identity = 24/29 (82.76%), Postives = 25/29 (86.21%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMS 88 LPEWVRIGFSGATG+ VE H ILSWSF S Sbjct: 247 LPEWVRIGFSGATGEKVETHDILSWSFTS 275
BLAST of AJ308146 vs. Soybean peptides
Match: Glyma08g37330.1|PACid:16273057 () HSP 1 Score: 50.0618 bits (118), Expect = 5.355e-7 Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPE+V +GFSGATG L+E H+ILSW+F SSF Sbjct: 225 LPEFVSVGFSGATGVLIEDHEILSWTFSSSF 255
BLAST of AJ308146 vs. Soybean peptides
Match: Glyma18g27290.1|PACid:16309366 () HSP 1 Score: 49.6766 bits (117), Expect = 6.994e-7 Identity = 22/30 (73.33%), Postives = 25/30 (83.33%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSS 91 LPE+VRIGFS ATG +E+H ILSWSF SS Sbjct: 208 LPEFVRIGFSAATGSWIEIHNILSWSFSSS 237
BLAST of AJ308146 vs. Soybean peptides
Match: Glyma09g33440.1|PACid:16277047 () HSP 1 Score: 49.2914 bits (116), Expect = 9.134e-7 Identity = 23/29 (79.31%), Postives = 23/29 (79.31%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMS 88 L EWV IGFSGATG LVE H ILSWSF S Sbjct: 241 LSEWVLIGFSGATGDLVETHDILSWSFNS 269
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g068040.1 (Lectin alpha chain (AHRD V1 *-*- P81637); contains Interpro domain(s) IPR016363 L-type lectin, plant chr08_pseudomolecule_IMGAG_V3.5 17436664-17437452 H EGN_Mt100125 20100825) HSP 1 Score: 64.3142 bits (155), Expect = 1.717e-11 Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPEWVRIGFSGATGQLVELHKILSW+F SSF Sbjct: 231 LPEWVRIGFSGATGQLVELHKILSWTFKSSF 261
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g068030.1 (Lectin alpha chain (AHRD V1 *-*- P81637); contains Interpro domain(s) IPR016363 L-type lectin, plant chr08_pseudomolecule_IMGAG_V3.5 17433416-17434441 E EGN_Mt100125 20100825) HSP 1 Score: 64.3142 bits (155), Expect = 1.717e-11 Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPEWVRIGFSGATGQLVELHKILSW+F SSF Sbjct: 235 LPEWVRIGFSGATGQLVELHKILSWTFKSSF 265
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g067820.1 (Lectin alpha chain (AHRD V1 *-*- P81637); contains Interpro domain(s) IPR016363 L-type lectin, plant chr08_pseudomolecule_IMGAG_V3.5 17368523-17367735 H EGN_Mt100125 20100825) HSP 1 Score: 64.3142 bits (155), Expect = 1.717e-11 Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPEWVRIGFSGATGQLVELHKILSW+F SSF Sbjct: 231 LPEWVRIGFSGATGQLVELHKILSWTFKSSF 261
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g067660.1 (Lectin alpha chain (AHRD V1 *-*- P81637); contains Interpro domain(s) IPR016363 L-type lectin, plant chr08_pseudomolecule_IMGAG_V3.5 17310255-17309230 E EGN_Mt100125 20100825) HSP 1 Score: 64.3142 bits (155), Expect = 1.717e-11 Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSF 94 LPEWVRIGFSGATGQLVELHKILSW+F SSF Sbjct: 235 LPEWVRIGFSGATGQLVELHKILSWTFKSSF 265
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr5g031140.1 (Lectin alpha chain (AHRD V1 *-*- P81637); contains Interpro domain(s) IPR000985 Legume lectin, alpha chain, conserved site chr05_pseudomolecule_IMGAG_V3.5 12919376-12920377 E EGN_Mt100125 20100825) HSP 1 Score: 53.9138 bits (128), Expect = 2.320e-8 Identity = 22/30 (73.33%), Postives = 27/30 (90.00%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSS 91 LPEWVR+GFS ATG+LVE+H I++WSF SS Sbjct: 256 LPEWVRVGFSAATGELVEIHDIINWSFESS 285
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g067990.1 (Lectin-like protein (AHRD V1 ***- Q2PP76_MEDTR); contains Interpro domain(s) IPR001220 Legume lectin, beta chain chr08_pseudomolecule_IMGAG_V3.5 17419879-17420713 E EGN_Mt100125 20100825) HSP 1 Score: 52.7582 bits (125), Expect = 5.168e-8 Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSFY*Y 103 LP+W+ +GFSGATG LVE HKILSW+F S Y Y Sbjct: 229 LPDWIIVGFSGATGGLVETHKILSWTFSSYKYSY 262
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g067880.1 (Lectin-like protein (AHRD V1 ***- Q2PP76_MEDTR); contains Interpro domain(s) IPR001220 Legume lectin, beta chain chr08_pseudomolecule_IMGAG_V3.5 17384949-17385783 E EGN_Mt100125 20100825) HSP 1 Score: 52.7582 bits (125), Expect = 5.168e-8 Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSSFY*Y 103 LP+W+ +GFSGATG LVE HKILSW+F S Y Y Sbjct: 229 LPDWIIVGFSGATGGLVETHKILSWTFSSYKYSY 262
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g067980.1 (Lectin (AHRD V1 ***- A9YWS5_MEDTR); contains Interpro domain(s) IPR016363 L-type lectin, plant chr08_pseudomolecule_IMGAG_V3.5 17415572-17416354 H EGN_Mt100125 20100825) HSP 1 Score: 51.9878 bits (123), Expect = 8.816e-8 Identity = 23/30 (76.67%), Postives = 25/30 (83.33%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSS 91 LPEWV +GFSGATG VE HKILSW+F SS Sbjct: 229 LPEWVIVGFSGATGGFVETHKILSWNFNSS 258
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g067810.1 (Lectin (AHRD V1 ***- A9YWS5_MEDTR); contains Interpro domain(s) IPR016363 L-type lectin, plant chr08_pseudomolecule_IMGAG_V3.5 17363350-17364132 H EGN_Mt100125 20100825) HSP 1 Score: 51.9878 bits (123), Expect = 8.816e-8 Identity = 23/30 (76.67%), Postives = 25/30 (83.33%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSS 91 LPEWV +GFSGATG VE HKILSW+F SS Sbjct: 229 LPEWVIVGFSGATGGFVETHKILSWNFNSS 258
BLAST of AJ308146 vs. Medicago proteins
Match: IMGA|Medtr8g068050.1 (Lectin receptor-like kinase Tg-20 (Fragment) (AHRD V1 *-*- A6YFC5_MUSAC); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase chr08_pseudomolecule_IMGAG_V3.5 17443088-17440923 E EGN_Mt100125 20100825) HSP 1 Score: 50.447 bits (119), Expect = 2.565e-7 Identity = 22/30 (73.33%), Postives = 26/30 (86.67%), Query Frame = 2 Query: 2 LPEWVRIGFSGATGQLVELHKILSWSFMSS 91 LPE+VRIGFS ATGQ +E+H IL+WSF SS Sbjct: 243 LPEYVRIGFSAATGQWIEIHNILTWSFNSS 272 The following BLAST results are available for this feature:
BLAST of AJ308146 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 1
BLAST of AJ308146 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl) Total hits: 1
BLAST of AJ308146 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 7
BLAST of AJ308146 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 6
BLAST of AJ308146 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 10
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AJ308146 ID=AJ308146; Name=AJ308146; organism=Pisum sativum; type=EST; length=259bpback to top |