AA430902

EST Overview
NameAA430902
Unique NameAA430902
TypeEST
OrganismPisum sativum (pea)
Sequence length330
Libraries
Library NameType
LIBEST_000872 Whero seedling lambda ZapII cDNA librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of AA430902 vs. TrEMBL
Match: B7FMJ8_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.980e-20
Identity = 50/64 (78.12%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGKFSQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKFSQVVSNQLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TrEMBL
Match: B7FH21_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.980e-20
Identity = 50/64 (78.12%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGKFSQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKFSQVVSNQLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TrEMBL
Match: Q8H590_ORYSJ (40S ribosomal protein S18, putative, expressed OS=Oryza sativa subsp. japonica GN=OJ1656_E11.104 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDG+FSQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGRFSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TrEMBL
Match: Q8H588_ORYSJ (Putative ribosomal protein S18 OS=Oryza sativa subsp. japonica GN=OJ1656_E11.108 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDG+FSQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   85 DYKDGRFSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 148          
BLAST of AA430902 vs. TrEMBL
Match: Q8H583_ORYSJ (Ribosomal protein S18-like OS=Oryza sativa subsp. japonica GN=OJ1656_E11.114 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDG+FSQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   82 DYKDGRFSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 145          
BLAST of AA430902 vs. TrEMBL
Match: Q5PNZ9_ARATH (At1g22780 OS=Arabidopsis thaliana GN=PFL PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TrEMBL
Match: D7KJD2_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_472522 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TrEMBL
Match: D2D961_9ROSI (S18.A ribosomal protein OS=Jatropha curcas PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TrEMBL
Match: C6T0A7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TrEMBL
Match: C6T048_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_ARATH (40S ribosomal protein S18 OS=Arabidopsis thaliana GN=RPS18A PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.256e-21
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_RAT (40S ribosomal protein S18 OS=Rattus norvegicus GN=Rps18 PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_PIG (40S ribosomal protein S18 OS=Sus scrofa GN=RPS18 PE=2 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_MOUSE (40S ribosomal protein S18 OS=Mus musculus GN=Rps18 PE=2 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_ICTPU (40S ribosomal protein S18 OS=Ictalurus punctatus GN=rps18 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_HUMAN (40S ribosomal protein S18 OS=Homo sapiens GN=RPS18 PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_DANRE (40S ribosomal protein S18 OS=Danio rerio GN=rps18 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DIKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_CAPHI (40S ribosomal protein S18 OS=Capra hircus GN=RPS18 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_CANFA (40S ribosomal protein S18 OS=Canis familiaris GN=RPS18 PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. SwissProt
Match: RS18_BOVIN (40S ribosomal protein S18 OS=Bos taurus GN=RPS18 PE=2 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.100e-17
Identity = 42/64 (65.62%), Postives = 48/64 (75.00%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            D KDGK+SQV++NGLD KLR+DLERLKKIR HRGLRH+WGLRVRGQH             SKK+
Sbjct:   89 DVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK 152          
BLAST of AA430902 vs. TAIR peptide
Match: AT4G09800.1 (| Symbols: RPS18C | S18 ribosomal protein | chr4:6173818-6174963 FORWARD LENGTH=152)

HSP 1 Score: 101.679 bits (252), Expect = 9.951e-23
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TAIR peptide
Match: AT1G34030.1 (| Symbols: | Ribosomal protein S13/S18 family | chr1:12370285-12371465 REVERSE LENGTH=152)

HSP 1 Score: 101.679 bits (252), Expect = 9.951e-23
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
BLAST of AA430902 vs. TAIR peptide
Match: AT1G22780.1 (| Symbols: PFL, RPS18A, PFL1 | Ribosomal protein S13/S18 family | chr1:8067990-8069163 FORWARD LENGTH=152)

HSP 1 Score: 101.679 bits (252), Expect = 9.951e-23
Identity = 49/64 (76.56%), Postives = 50/64 (78.12%), Query Frame = 3
Query:    3 DYKDGKFSQVVSNGLDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 194
            DYKDGK+SQVVSN LDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH             SKKR
Sbjct:   89 DYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152          
The following BLAST results are available for this feature:
BLAST of AA430902 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B7FMJ8_MEDTR1.980e-2078.13Putative uncharacterized protein OS=Medicago trunc... [more]
B7FH21_MEDTR1.980e-2078.13Putative uncharacterized protein OS=Medicago trunc... [more]
Q8H590_ORYSJ2.587e-2076.5640S ribosomal protein S18, putative, expressed OS=... [more]
Q8H588_ORYSJ2.587e-2076.56Putative ribosomal protein S18 OS=Oryza sativa sub... [more]
Q8H583_ORYSJ2.587e-2076.56Ribosomal protein S18-like OS=Oryza sativa subsp. ... [more]
Q5PNZ9_ARATH2.587e-2076.56At1g22780 OS=Arabidopsis thaliana GN=PFL PE=2 SV=1[more]
D7KJD2_ARALY2.587e-2076.56Putative uncharacterized protein OS=Arabidopsis ly... [more]
D2D961_9ROSI2.587e-2076.56S18.A ribosomal protein OS=Jatropha curcas PE=2 SV... [more]
C6T0A7_SOYBN2.587e-2076.56Putative uncharacterized protein OS=Glycine max PE... [more]
C6T048_SOYBN2.587e-2076.56Putative uncharacterized protein OS=Glycine max PE... [more]
back to top
BLAST of AA430902 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
RS18_ARATH1.256e-2176.5640S ribosomal protein S18 OS=Arabidopsis thaliana ... [more]
RS18_RAT1.100e-1765.6340S ribosomal protein S18 OS=Rattus norvegicus GN=... [more]
RS18_PIG1.100e-1765.6340S ribosomal protein S18 OS=Sus scrofa GN=RPS18 P... [more]
RS18_MOUSE1.100e-1765.6340S ribosomal protein S18 OS=Mus musculus GN=Rps18... [more]
RS18_ICTPU1.100e-1765.6340S ribosomal protein S18 OS=Ictalurus punctatus G... [more]
RS18_HUMAN1.100e-1765.6340S ribosomal protein S18 OS=Homo sapiens GN=RPS18... [more]
RS18_DANRE1.100e-1765.6340S ribosomal protein S18 OS=Danio rerio GN=rps18 ... [more]
RS18_CAPHI1.100e-1765.6340S ribosomal protein S18 OS=Capra hircus GN=RPS18... [more]
RS18_CANFA1.100e-1765.6340S ribosomal protein S18 OS=Canis familiaris GN=R... [more]
RS18_BOVIN1.100e-1765.6340S ribosomal protein S18 OS=Bos taurus GN=RPS18 P... [more]
back to top
BLAST of AA430902 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 3
Match NameE-valueIdentityDescription
AT4G09800.19.951e-2376.56| Symbols: RPS18C | S18 ribosomal protein | chr4:6... [more]
AT1G34030.19.951e-2376.56| Symbols: | Ribosomal protein S13/S18 family | c... [more]
AT1G22780.19.951e-2376.56| Symbols: PFL, RPS18A, PFL1 | Ribosomal protein S... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001892Ribosomal protein S13PIRPIRSF002134Ribosomal protein, S13p/S13a/S18e/organellar S13 typescoord: 4..65
score: 2.3
IPR001892Ribosomal protein S13PFAMPF00416Ribosomal_S13coord: 9..54
score: 4.5
IPR001892Ribosomal protein S13PROFILEPS50159RIBOSOMAL_S13_2coord: 11..57
score: 18
IPR010979Ribosomal protein S13-like, H2THSUPERFAMILY46946S13-like H2TH domaincoord: 9..69
score: 7.5
IPR018269Ribosomal protein S13, conserved sitePROSITEPS00646RIBOSOMAL_S13_1coord: 33..46
score
NoneNo IPR availableGENE3D4.10.910.10no descriptioncoord: 18..64
score: 2.6
NoneNo IPR availablePANTHERPTHR1087130S/40S RIBOSOMAL PROTEINcoord: 1..64
score: 1.5
NoneNo IPR availablePANTHERPTHR10871:SF240S RIBOSOMAL PROTEIN S18coord: 1..64
score: 1.5
NoneNo IPR availableSEGsegsegcoord: 48..60
score
NoneNo IPR availableSEGsegsegcoord: 8..16
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>AA430902 ID=AA430902|Name=AA430902|organism=Pisum sativum|type=EST|length=330bp
AGGATTACAAGGATGGTAAATTCTCTCAAGTTGTCTCCAATGGACTTGAC
ATGAAGTTGAGAGATGATTTGGAGAGACTCAAGAAAATCAGAAATCACCG
TGGTTTGAGGCACTACTGGGGCCTTCGTGTTAGAGGTCAGCATACCAAGA
CTACTGGCCGCAGAGGAAAGACTGTTGGTGTCTCGAAGAAGCGTTTAGCT
GTTATGTTTTGATGACTCGGAGATTACATGATTTTGCGGAATTAATATTT
TAAGTTCAATAGACATGTTTCTTATACCCAACCTTTGTATGATTGTTAAA
TGTCCTGACAATTTATTTCAATTTTGTTTG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0003723RNA binding
GO:0003735structural constituent of ribosome
GO:0003676nucleic acid binding
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
Vocabulary: Biological Process
TermDefinition
GO:0006412translation
Vocabulary: INTERPRO
TermDefinition
IPR001892Ribosomal_S13
IPR010979Ribosomal_S13-like_H2TH
IPR018269Ribosomal_S13_CS