CD858907

EST Overview
NameCD858907
Unique NameCD858907
TypeEST
OrganismPisum sativum (pea)
Sequence length359
Libraries
Library NameType
LIBEST_013997 CIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD858907 vs. TrEMBL
Match: C6TM65_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 6.927e-50
Identity = 96/120 (80.00%), Postives = 110/120 (91.67%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSL-GGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAM+ APD NNRPLFAAKDIKPFY++H PKIF QH G+GG +LAKV++SL GGPKYDGKYLH VVR+KLGDI+L+ET+TNVVIPTFDIK+LQPIIFSSYQIK +P L+AKLSDICI
Sbjct:   69 GGLVTAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKYDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKLSDICI 188          
BLAST of CD858907 vs. TrEMBL
Match: B9R7G5_RICCO (Patatin T5, putative OS=Ricinus communis GN=RCOM_1591460 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.309e-40
Identity = 81/119 (68.07%), Postives = 97/119 (81.51%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+NNRPLFAAKDIK FYL HCPKIF Q +      + KV++ + GPKY+GKYLH +VR+KLG  +L+ET+TN+VIPTFDIK LQP IFSSY++KK P L+A LSDICI
Sbjct:   69 GGLVTAMLTAPDENNRPLFAAKDIKDFYLNHCPKIFPQPKWPLFSQVKKVVKGISGPKYNGKYLHGLVREKLGKRRLHETLTNIVIPTFDIKQLQPTIFSSYEVKKQPSLDALLSDICI 187          
BLAST of CD858907 vs. TrEMBL
Match: B9R7G2_RICCO (Patatin, putative OS=Ricinus communis GN=RCOM_1591330 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 3.810e-40
Identity = 77/119 (64.71%), Postives = 98/119 (82.35%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAMLA+P++ NRP+FAAKDI  FYL  CPKIF QHR      ++KV++++ GPKYDGKYLH +V++KLG+ +LN+T+TNV+IPTFDIK LQP IFSS+Q+K    LNA+LSDICI
Sbjct:   66 GGLVTAMLASPNEKNRPIFAAKDINEFYLNECPKIFPQHRFQLFAQVSKVIKAIAGPKYDGKYLHNLVKEKLGNTRLNQTLTNVIIPTFDIKKLQPTIFSSFQVKNNSSLNARLSDICI 184          
BLAST of CD858907 vs. TrEMBL
Match: Q9FZ09_TOBAC (Patatin-like protein 1 OS=Nicotiana tabacum GN=PAT1 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 8.488e-40
Identity = 79/119 (66.39%), Postives = 98/119 (82.35%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+N+RPL+AAKDI PFYLEHCPKIF Q +      +  +++++ GPKYDGKYLHEVV++KL D +L+ TITNVVIPTFDIK LQP IFS+Y+ K++ C +AKLSDICI
Sbjct:   72 GGLVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDICI 190          
BLAST of CD858907 vs. TrEMBL
Match: A5C9Q5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_008805 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.109e-39
Identity = 78/119 (65.55%), Postives = 100/119 (84.03%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD   RPLFAAK+I PFYLEH PKIF + RGI G +++ ++RSL GPKYDGKYL  + ++KLG  +L+ET+T+VVIPTFDIK+LQP IFS+Y++K++PCL+A L+DICI
Sbjct:   61 GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPZTRGIFGWIMS-IVRSLIGPKYDGKYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICI 178          
BLAST of CD858907 vs. TrEMBL
Match: B9R7G7_RICCO (Patatin T5, putative OS=Ricinus communis GN=RCOM_1591480 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.891e-39
Identity = 78/119 (65.55%), Postives = 97/119 (81.51%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAMLA P++ NRP+FAAKDIK FYL  CPKIF QH       +++V+R+L GPKY+GKYLH +V++KLG+ KLN+T+TNVVIPTFDIK LQP +FSS+Q+KK   LNA LSD+CI
Sbjct:   67 GGLVTAMLACPNEKNRPVFAAKDIKDFYLNECPKIFPQHSWKLFPHVSRVIRALSGPKYNGKYLHNLVKEKLGNTKLNQTLTNVVIPTFDIKRLQPTVFSSFQVKKDSSLNALLSDVCI 185          
BLAST of CD858907 vs. TrEMBL
Match: B9R7G6_RICCO (Patatin T5, putative OS=Ricinus communis GN=RCOM_1591470 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.891e-39
Identity = 76/119 (63.87%), Postives = 98/119 (82.35%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAMLA+P++ NRP+FAAKDIK FYL  CPKIF QH       ++KV++++ GPKYDGKYLH +V++KLG+ +LN+T+TN+VIPTFD+K LQP IFSS+Q+K  P +NA LSDICI
Sbjct:   66 GGLVTAMLASPNEKNRPVFAAKDIKDFYLNECPKIFPQH--CWQPQVSKVIKAIAGPKYDGKYLHNLVKEKLGNTRLNQTLTNIVIPTFDVKKLQPTIFSSFQVKNNPSINALLSDICI 182          
BLAST of CD858907 vs. TrEMBL
Match: Q9AQT8_VIGUN (Patatin-like protein OS=Vigna unguiculata PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 9.384e-39
Identity = 83/120 (69.17%), Postives = 95/120 (79.17%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLA-KVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML AP++NNRPL+AAKDIK FYLEH PKIF Q      +  A K  RSL GP+YDGKYLH++VR+KLG+ KL  T+TNVVIP FDIK LQP IFSS+Q+KK P LNA LSDICI
Sbjct:   65 GGLVTAMLTAPNENNRPLYAAKDIKDFYLEHTPKIFPQSSSWNLIATAMKKGRSLMGPQYDGKYLHKLVREKLGNTKLEHTLTNVVIPAFDIKNLQPAIFSSFQVKKRPYLNAALSDICI 184          
BLAST of CD858907 vs. TrEMBL
Match: B9R7G4_RICCO (Patatin T5, putative OS=Ricinus communis GN=RCOM_1591450 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.730e-38
Identity = 77/119 (64.71%), Postives = 93/119 (78.15%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  P++ NRPLFAAKDI  FYLEHCPKIF Q           ++RSL GPKYDG YLHEVVR+KLG+ +L++T+ +V+IPTFDIK LQP +FSSY++KK P +NA LSDICI
Sbjct:   66 GGLVTAMLTTPNEQNRPLFAAKDINDFYLEHCPKIFPQDTSAFAPA-TNLVRSLRGPKYDGAYLHEVVREKLGETRLDQTLAHVIIPTFDIKRLQPTVFSSYEVKKNPSMNALLSDICI 183          
BLAST of CD858907 vs. TrEMBL
Match: A5AUQ2_VITVI (Putative uncharacterized protein (Fragment) OS=Vitis vinifera GN=VITISV_001725 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.730e-38
Identity = 78/120 (65.00%), Postives = 96/120 (80.00%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNN-RPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  P++N  RPLF+AKDIK FYL+HCPKIF QH       + KV+ +L GPKYDGKYLH +V++KLG+ +L++T+TNVVIPTFDIK LQP IFS+YQ+K  P L+A LSDICI
Sbjct:   67 GGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKYDGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICI 186          
BLAST of CD858907 vs. SwissProt
Match: PAT05_SOLTU (Patatin-05 OS=Solanum tuberosum GN=pat1-k1 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.805e-27
Identity = 57/118 (48.31%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H P IF    G              GPKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+SDIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIFNSSTG-----------QFFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMSDIC 185          
BLAST of CD858907 vs. SwissProt
Match: PAT13_SOLTU (Patatin-13 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.293e-26
Identity = 57/118 (48.31%), Postives = 79/118 (66.95%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H P IF    G              GPKYDGKYL +V ++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+SDIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIFNSSTG-----------QFFGPKYDGKYLMQVPQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMSDIC 185          
BLAST of CD858907 vs. SwissProt
Match: PAT07_SOLTU (Patatin-07 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.293e-26
Identity = 57/118 (48.31%), Postives = 81/118 (68.64%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY EH P IF                S+ GP+YDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+SDIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIFNYSG------------SIFGPRYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMSDIC 184          
BLAST of CD858907 vs. SwissProt
Match: PAT03_SOLTU (Patatin-03 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.293e-26
Identity = 56/118 (47.46%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H P IF    G              GPKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + ++P L+AK+SDIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIFNSSTG-----------QFFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLARSPELDAKMSDIC 185          
BLAST of CD858907 vs. SwissProt
Match: PATT5_SOLTU (Patatin-T5 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.689e-26
Identity = 59/118 (50.00%), Postives = 82/118 (69.49%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++ NRP  AAKDI PFY EH PKIF Q  G           S+ GPKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNETNRPFAAAKDIVPFYFEHGPKIF-QSSG-----------SIFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 184          
BLAST of CD858907 vs. SwissProt
Match: PAT11_SOLTU (Patatin-11 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.881e-26
Identity = 56/118 (47.46%), Postives = 79/118 (66.95%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H P IF    G              GPKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIFNSSTG-----------QFFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 185          
BLAST of CD858907 vs. SwissProt
Match: PT3K1_SOLTU (Patatin-3-Kuras 1 OS=Solanum tuberosum GN=pat3-k1 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.914e-26
Identity = 58/118 (49.15%), Postives = 81/118 (68.64%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H PKIF       G  L +       PKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + KTP L+AK+ DIC
Sbjct:   67 GGLLTAMITTPNENNRPFAAAKDIIPFYFDHGPKIFEP----SGFHLVE-------PKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKTPELDAKMYDIC 173          
BLAST of CD858907 vs. SwissProt
Match: PATM3_SOLTU (Patatin group M-3 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.382e-26
Identity = 57/118 (48.31%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFYLEH P IF                S+ GP YDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYLEHGPHIFNYSG------------SIIGPMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 184          
BLAST of CD858907 vs. SwissProt
Match: PATB1_SOLTU (Patatin-B1 OS=Solanum tuberosum GN=PATB1 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 8.382e-26
Identity = 56/118 (47.46%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY EH P IF                S+ GP+YDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIFNYSG------------SIFGPRYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 184          
BLAST of CD858907 vs. SwissProt
Match: PAT15_SOLTU (Patatin-15 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.382e-26
Identity = 56/118 (47.46%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY EH P IF                S+ GP+YDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIFNYSG------------SIFGPRYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 184          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37060.2 (| Symbols: PLP5 | PATATIN-like protein 5 | chr4:17461573-17463704 REVERSE LENGTH=435)

HSP 1 Score: 152.525 bits (384), Expect = 4.936e-38
Identity = 76/119 (63.87%), Postives = 89/119 (74.79%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+N RP FAAK+I PFYLEHCPKIF Q  G+  + L K+ + L GPKY G YL   + + LG+ KL +T+TNVVIPTFDIKTLQP IFSSYQ    P L+ K+SDICI
Sbjct:   89 GGLVTAMLTAPDENGRPRFAAKEIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGNYLRTTLGKLLGETKLRQTLTNVVIPTFDIKTLQPTIFSSYQALTDPSLDVKVSDICI 206          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37060.1 (| Symbols: PLP5, PLA IVB, AtPLAIVB | PATATIN-like protein 5 | chr4:17461573-17463734 REVERSE LENGTH=414)

HSP 1 Score: 152.525 bits (384), Expect = 4.936e-38
Identity = 76/119 (63.87%), Postives = 89/119 (74.79%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+N RP FAAK+I PFYLEHCPKIF Q  G+  + L K+ + L GPKY G YL   + + LG+ KL +T+TNVVIPTFDIKTLQP IFSSYQ    P L+ K+SDICI
Sbjct:   68 GGLVTAMLTAPDENGRPRFAAKEIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGNYLRTTLGKLLGETKLRQTLTNVVIPTFDIKTLQPTIFSSYQALTDPSLDVKVSDICI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37070.4 (| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr4:17465167-17467058 REVERSE LENGTH=372)

HSP 1 Score: 150.214 bits (378), Expect = 2.450e-37
Identity = 73/119 (61.34%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  PD+  RP FAAKDI PFYLEHCPKIF Q  G+  + L K+ + L GPKY GKYL  ++ + LG+ +L++T+TN+VIPTFDIK LQP IFSSYQ+   P L+ K+SDICI
Sbjct:   57 GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGKYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICI 174          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37070.1 (| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr4:17465167-17467058 REVERSE LENGTH=383)

HSP 1 Score: 150.214 bits (378), Expect = 2.450e-37
Identity = 73/119 (61.34%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  PD+  RP FAAKDI PFYLEHCPKIF Q  G+  + L K+ + L GPKY GKYL  ++ + LG+ +L++T+TN+VIPTFDIK LQP IFSSYQ+   P L+ K+SDICI
Sbjct:   68 GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGKYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37070.3 (| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr4:17465167-17467058 REVERSE LENGTH=383)

HSP 1 Score: 150.214 bits (378), Expect = 2.450e-37
Identity = 73/119 (61.34%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  PD+  RP FAAKDI PFYLEHCPKIF Q  G+  + L K+ + L GPKY GKYL  ++ + LG+ +L++T+TN+VIPTFDIK LQP IFSSYQ+   P L+ K+SDICI
Sbjct:   68 GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGKYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37070.2 (| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr4:17464916-17467058 REVERSE LENGTH=414)

HSP 1 Score: 150.214 bits (378), Expect = 2.450e-37
Identity = 73/119 (61.34%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  PD+  RP FAAKDI PFYLEHCPKIF Q  G+  + L K+ + L GPKY GKYL  ++ + LG+ +L++T+TN+VIPTFDIK LQP IFSSYQ+   P L+ K+SDICI
Sbjct:   68 GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGKYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT2G26560.1 (| Symbols: PLP2, PLA IIA, PLA2A | phospholipase A 2A | chr2:11293912-11295708 REVERSE LENGTH=407)

HSP 1 Score: 149.058 bits (375), Expect = 5.458e-37
Identity = 74/119 (62.18%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML AP++  RPLFAA +IK FYLE CPKIF Q          K+++SL GPKYDGKYLH+++  KLGD KL++T+TNVVIPTFDIK LQP IFSSY++K  P  +A L+DI I
Sbjct:   68 GGLVTAMLTAPNKEGRPLFAASEIKDFYLEQCPKIFPQDH-FPFSAAKKLVKSLTGPKYDGKYLHQLIHAKLGDTKLSQTLTNVVIPTFDIKHLQPTIFSSYEVKNHPLKDATLADIAI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37050.1 (| Symbols: PLP4, PLA V, AtPLAIVC | PATATIN-like protein 4 | chr4:17457261-17459642 REVERSE LENGTH=428)

HSP 1 Score: 144.436 bits (363), Expect = 1.344e-35
Identity = 74/126 (58.73%), Postives = 90/126 (71.43%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQN-------NRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGL+ AML A DQ+       NRPLF AK+I PFYL+H PKIF Q RGI       ++R +GGPK++GKYLH++V   LGD KL +++TNVVIP FDIK LQP+IFSSYQ      +NAKLSDICI
Sbjct:   84 GGLIVAMLTAQDQSGGHSRNSNRPLFEAKEIVPFYLKHSPKIFPQPRGIFCGWGETIVRLVGGPKFNGKYLHDLVEGFLGDTKLTQSLTNVVIPCFDIKKLQPVIFSSYQAVNNQAMNAKLSDICI 209          
BLAST of CD858907 vs. TAIR peptide
Match: AT5G43590.1 (| Symbols: | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr5:17509368-17511477 REVERSE LENGTH=401)

HSP 1 Score: 132.88 bits (333), Expect = 4.048e-32
Identity = 70/119 (58.82%), Postives = 84/119 (70.59%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGL+TAML AP+ + RPL+AAKDI PFYLE  PKIF   +      L  + R    PKY+G+YLH  + + LG+ KL++T+TNVVIPTFDIK LQP IFSSY     P LNAKLSDICI
Sbjct:   64 GGLMTAMLTAPNDSGRPLYAAKDIVPFYLEESPKIFYGSKWWDPSALWALFR----PKYNGEYLHTRLGEILGETKLDQTLTNVVIPTFDIKKLQPTIFSSYHASVDPSLNAKLSDICI 178          
BLAST of CD858907 vs. TAIR peptide
Match: AT3G54950.1 (| Symbols: PLP7, PLA IIIA | patatin-like protein 6 | chr3:20359076-20360774 REVERSE LENGTH=488)

HSP 1 Score: 60.077 bits (144), Expect = 3.334e-10
Identity = 34/118 (28.81%), Postives = 61/118 (51.69%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GG+ TAML      NRP+F A D   F   +   ++      G  +L +V+R+  G       L +V+++   ++ L +T+  V+IP +D+K+  P +FS     +T   + +LS++C
Sbjct:  148 GGIYTAMLFGSRDGNRPIFKADDTWQFLTRNAKGLYG-----GAGILKRVLRTGSGCCSGTAKLKKVMKESFSELTLKDTLKPVLIPCYDLKSSGPFLFSRADALETDGYDFRLSEVC 260          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37060.2 (| Symbols: PLP5 | PATATIN-like protein 5 | chr4:17461573-17463704 REVERSE LENGTH=435)

HSP 1 Score: 152.525 bits (384), Expect = 4.936e-38
Identity = 76/119 (63.87%), Postives = 89/119 (74.79%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+N RP FAAK+I PFYLEHCPKIF Q  G+  + L K+ + L GPKY G YL   + + LG+ KL +T+TNVVIPTFDIKTLQP IFSSYQ    P L+ K+SDICI
Sbjct:   89 GGLVTAMLTAPDENGRPRFAAKEIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGNYLRTTLGKLLGETKLRQTLTNVVIPTFDIKTLQPTIFSSYQALTDPSLDVKVSDICI 206          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37060.1 (| Symbols: PLP5, PLA IVB, AtPLAIVB | PATATIN-like protein 5 | chr4:17461573-17463734 REVERSE LENGTH=414)

HSP 1 Score: 152.525 bits (384), Expect = 4.936e-38
Identity = 76/119 (63.87%), Postives = 89/119 (74.79%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+N RP FAAK+I PFYLEHCPKIF Q  G+  + L K+ + L GPKY G YL   + + LG+ KL +T+TNVVIPTFDIKTLQP IFSSYQ    P L+ K+SDICI
Sbjct:   68 GGLVTAMLTAPDENGRPRFAAKEIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGNYLRTTLGKLLGETKLRQTLTNVVIPTFDIKTLQPTIFSSYQALTDPSLDVKVSDICI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37070.4 (| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr4:17465167-17467058 REVERSE LENGTH=372)

HSP 1 Score: 150.214 bits (378), Expect = 2.450e-37
Identity = 73/119 (61.34%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  PD+  RP FAAKDI PFYLEHCPKIF Q  G+  + L K+ + L GPKY GKYL  ++ + LG+ +L++T+TN+VIPTFDIK LQP IFSSYQ+   P L+ K+SDICI
Sbjct:   57 GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGKYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICI 174          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37070.1 (| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr4:17465167-17467058 REVERSE LENGTH=383)

HSP 1 Score: 150.214 bits (378), Expect = 2.450e-37
Identity = 73/119 (61.34%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  PD+  RP FAAKDI PFYLEHCPKIF Q  G+  + L K+ + L GPKY GKYL  ++ + LG+ +L++T+TN+VIPTFDIK LQP IFSSYQ+   P L+ K+SDICI
Sbjct:   68 GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGKYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37070.3 (| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr4:17465167-17467058 REVERSE LENGTH=383)

HSP 1 Score: 150.214 bits (378), Expect = 2.450e-37
Identity = 73/119 (61.34%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  PD+  RP FAAKDI PFYLEHCPKIF Q  G+  + L K+ + L GPKY GKYL  ++ + LG+ +L++T+TN+VIPTFDIK LQP IFSSYQ+   P L+ K+SDICI
Sbjct:   68 GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGKYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37070.2 (| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr4:17464916-17467058 REVERSE LENGTH=414)

HSP 1 Score: 150.214 bits (378), Expect = 2.450e-37
Identity = 73/119 (61.34%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML  PD+  RP FAAKDI PFYLEHCPKIF Q  G+  + L K+ + L GPKY GKYL  ++ + LG+ +L++T+TN+VIPTFDIK LQP IFSSYQ+   P L+ K+SDICI
Sbjct:   68 GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLAL-LPKLPKLLSGPKYSGKYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIFSSYQLLVDPSLDVKVSDICI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT2G26560.1 (| Symbols: PLP2, PLA IIA, PLA2A | phospholipase A 2A | chr2:11293912-11295708 REVERSE LENGTH=407)

HSP 1 Score: 149.058 bits (375), Expect = 5.458e-37
Identity = 74/119 (62.18%), Postives = 90/119 (75.63%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML AP++  RPLFAA +IK FYLE CPKIF Q          K+++SL GPKYDGKYLH+++  KLGD KL++T+TNVVIPTFDIK LQP IFSSY++K  P  +A L+DI I
Sbjct:   68 GGLVTAMLTAPNKEGRPLFAASEIKDFYLEQCPKIFPQDH-FPFSAAKKLVKSLTGPKYDGKYLHQLIHAKLGDTKLSQTLTNVVIPTFDIKHLQPTIFSSYEVKNHPLKDATLADIAI 185          
BLAST of CD858907 vs. TAIR peptide
Match: AT4G37050.1 (| Symbols: PLP4, PLA V, AtPLAIVC | PATATIN-like protein 4 | chr4:17457261-17459642 REVERSE LENGTH=428)

HSP 1 Score: 144.436 bits (363), Expect = 1.344e-35
Identity = 74/126 (58.73%), Postives = 90/126 (71.43%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQN-------NRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGL+ AML A DQ+       NRPLF AK+I PFYL+H PKIF Q RGI       ++R +GGPK++GKYLH++V   LGD KL +++TNVVIP FDIK LQP+IFSSYQ      +NAKLSDICI
Sbjct:   84 GGLIVAMLTAQDQSGGHSRNSNRPLFEAKEIVPFYLKHSPKIFPQPRGIFCGWGETIVRLVGGPKFNGKYLHDLVEGFLGDTKLTQSLTNVVIPCFDIKKLQPVIFSSYQAVNNQAMNAKLSDICI 209          
BLAST of CD858907 vs. TAIR peptide
Match: AT5G43590.1 (| Symbols: | Acyl transferase/acyl hydrolase/lysophospholipase superfamily protein | chr5:17509368-17511477 REVERSE LENGTH=401)

HSP 1 Score: 132.88 bits (333), Expect = 4.048e-32
Identity = 70/119 (58.82%), Postives = 84/119 (70.59%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGL+TAML AP+ + RPL+AAKDI PFYLE  PKIF   +      L  + R    PKY+G+YLH  + + LG+ KL++T+TNVVIPTFDIK LQP IFSSY     P LNAKLSDICI
Sbjct:   64 GGLMTAMLTAPNDSGRPLYAAKDIVPFYLEESPKIFYGSKWWDPSALWALFR----PKYNGEYLHTRLGEILGETKLDQTLTNVVIPTFDIKKLQPTIFSSYHASVDPSLNAKLSDICI 178          
BLAST of CD858907 vs. TAIR peptide
Match: AT3G54950.1 (| Symbols: PLP7, PLA IIIA | patatin-like protein 6 | chr3:20359076-20360774 REVERSE LENGTH=488)

HSP 1 Score: 60.077 bits (144), Expect = 3.334e-10
Identity = 34/118 (28.81%), Postives = 61/118 (51.69%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GG+ TAML      NRP+F A D   F   +   ++      G  +L +V+R+  G       L +V+++   ++ L +T+  V+IP +D+K+  P +FS     +T   + +LS++C
Sbjct:  148 GGIYTAMLFGSRDGNRPIFKADDTWQFLTRNAKGLYG-----GAGILKRVLRTGSGCCSGTAKLKKVMKESFSELTLKDTLKPVLIPCYDLKSSGPFLFSRADALETDGYDFRLSEVC 260          
BLAST of CD858907 vs. TrEMBL
Match: C6TM65_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 8.663e-50
Identity = 96/120 (80.00%), Postives = 110/120 (91.67%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSL-GGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAM+ APD NNRPLFAAKDIKPFY++H PKIF QH G+GG +LAKV++SL GGPKYDGKYLH VVR+KLGDI+L+ET+TNVVIPTFDIK+LQPIIFSSYQIK +P L+AKLSDICI
Sbjct:   69 GGLVTAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKYDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLDAKLSDICI 188          
BLAST of CD858907 vs. TrEMBL
Match: E0CPA0_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_1.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00009548001 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 9.600e-41
Identity = 79/119 (66.39%), Postives = 102/119 (85.71%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GG+VTAML APD   RPLFAAKDIKPFYLEH PKIF Q RGI G +++ ++RS+ GPKYDGKYL  ++++KLG  +L+ET+T+VVIPTFDIK+LQP IFS+Y++K++PCL+A L+DICI
Sbjct:   67 GGIVTAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMS-ILRSIVGPKYDGKYLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICI 184          
BLAST of CD858907 vs. TrEMBL
Match: E0CP99_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_1.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00009547001 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 9.600e-41
Identity = 79/119 (66.39%), Postives = 102/119 (85.71%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GG+VTAML APD   RPLFAAKDIKPFYLEH PKIF Q RGI G +++ ++RS+ GPKYDGKYL  ++++KLG  +L+ET+T+VVIPTFDIK+LQP IFS+Y++K++PCL+A L+DICI
Sbjct:   67 GGIVTAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMS-ILRSIVGPKYDGKYLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICI 184          
BLAST of CD858907 vs. TrEMBL
Match: B9R7G5_RICCO (Patatin T5, putative OS=Ricinus communis GN=RCOM_1591460 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.637e-40
Identity = 81/119 (68.07%), Postives = 97/119 (81.51%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+NNRPLFAAKDIK FYL HCPKIF Q +      + KV++ + GPKY+GKYLH +VR+KLG  +L+ET+TN+VIPTFDIK LQP IFSSY++KK P L+A LSDICI
Sbjct:   69 GGLVTAMLTAPDENNRPLFAAKDIKDFYLNHCPKIFPQPKWPLFSQVKKVVKGISGPKYNGKYLHGLVREKLGKRRLHETLTNIVIPTFDIKQLQPTIFSSYEVKKQPSLDALLSDICI 187          
BLAST of CD858907 vs. TrEMBL
Match: B9R7G2_RICCO (Patatin, putative OS=Ricinus communis GN=RCOM_1591330 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.764e-40
Identity = 77/119 (64.71%), Postives = 98/119 (82.35%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAMLA+P++ NRP+FAAKDI  FYL  CPKIF QHR      ++KV++++ GPKYDGKYLH +V++KLG+ +LN+T+TNV+IPTFDIK LQP IFSS+Q+K    LNA+LSDICI
Sbjct:   66 GGLVTAMLASPNEKNRPIFAAKDINEFYLNECPKIFPQHRFQLFAQVSKVIKAIAGPKYDGKYLHNLVKEKLGNTRLNQTLTNVIIPTFDIKKLQPTIFSSFQVKNNSSLNARLSDICI 184          
BLAST of CD858907 vs. TrEMBL
Match: Q9FZ09_TOBAC (Patatin-like protein 1 OS=Nicotiana tabacum GN=PAT1 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.061e-39
Identity = 79/119 (66.39%), Postives = 98/119 (82.35%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+N+RPL+AAKDI PFYLEHCPKIF Q +      +  +++++ GPKYDGKYLHEVV++KL D +L+ TITNVVIPTFDIK LQP IFS+Y+ K++ C +AKLSDICI
Sbjct:   72 GGLVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLSDICI 190          
BLAST of CD858907 vs. TrEMBL
Match: E0CPA3_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_1.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00009551001 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.061e-39
Identity = 79/119 (66.39%), Postives = 100/119 (84.03%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD   RPLFAAK+I PFYLEH PKIF Q RGI G +++ ++RSL GPKYDGKYL  + ++KLG  +L+ET+T+VVIPTFDIK+LQP IFS+Y++K++PCL+A L+DICI
Sbjct:   98 GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMS-IVRSLIGPKYDGKYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICI 215          
BLAST of CD858907 vs. TrEMBL
Match: E0CPA1_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_1.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00009549001 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.061e-39
Identity = 78/119 (65.55%), Postives = 101/119 (84.87%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD   RPLFAAK+I PFYLEH PKIF + RGI G +++ ++RSL GPKYDGKYL  ++++KLG  +L+ET+T+VVIPTFDIK+LQP IFS+Y++K++PCL+A L+DICI
Sbjct:   67 GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMS-IVRSLIGPKYDGKYLKRIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICI 184          
BLAST of CD858907 vs. TrEMBL
Match: A5C9Q5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_008805 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.386e-39
Identity = 78/119 (65.55%), Postives = 100/119 (84.03%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD   RPLFAAK+I PFYLEH PKIF + RGI G +++ ++RSL GPKYDGKYL  + ++KLG  +L+ET+T+VVIPTFDIK+LQP IFS+Y++K++PCL+A L+DICI
Sbjct:   61 GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPZTRGIFGWIMS-IVRSLIGPKYDGKYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICI 178          
BLAST of CD858907 vs. TrEMBL
Match: B9R7G7_RICCO (Patatin T5, putative OS=Ricinus communis GN=RCOM_1591480 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.365e-39
Identity = 78/119 (65.55%), Postives = 97/119 (81.51%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAMLA P++ NRP+FAAKDIK FYL  CPKIF QH       +++V+R+L GPKY+GKYLH +V++KLG+ KLN+T+TNVVIPTFDIK LQP +FSS+Q+KK   LNA LSD+CI
Sbjct:   67 GGLVTAMLACPNEKNRPVFAAKDIKDFYLNECPKIFPQHSWKLFPHVSRVIRALSGPKYNGKYLHNLVKEKLGNTKLNQTLTNVVIPTFDIKRLQPTVFSSFQVKKDSSLNALLSDVCI 185          
BLAST of CD858907 vs. Lotus protein
Match: chr1.CM2113.140.r2.m (+ phase: 0 )

HSP 1 Score: 179.489 bits (454), Expect = 2.467e-46
Identity = 83/119 (69.75%), Postives = 105/119 (88.24%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML+AP+   RPLFAAKDIKPFYLEHCP IF QHRG   + +  + +++GGPKY+GKYLH+VV++KLG+I+++ET+TNVVIPTFDIKT+QP IFSSY+IK +PCL+A+LSDICI
Sbjct:   69 GGLVTAMLSAPNDKQRPLFAAKDIKPFYLEHCPMIFPQHRG-PLVSIRNLFKTIGGPKYNGKYLHKVVKEKLGEIRVHETLTNVVIPTFDIKTMQPTIFSSYKIKSSPCLDAQLSDICI 186          
BLAST of CD858907 vs. Lotus protein
Match: chr1.CM2113.20.r2.a (- phase: 0 )

HSP 1 Score: 178.333 bits (451), Expect = 5.495e-46
Identity = 82/119 (68.91%), Postives = 104/119 (87.39%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML+AP+   RPLFAAKDIKPFYLEHCPKIF QHRG   + +  +++S+ GPKY+GKYLH+VVR+KLG+ +++ET+TNVVIPTFDIKT+QP IFSSY+IK +PC +A+LSD+CI
Sbjct:   69 GGLVTAMLSAPNDKQRPLFAAKDIKPFYLEHCPKIFPQHRG-PFVSIRNLLKSIRGPKYNGKYLHKVVREKLGETRVHETLTNVVIPTFDIKTMQPTIFSSYKIKNSPCFDAQLSDVCI 186          
BLAST of CD858907 vs. Lotus protein
Match: chr1.CM2113.100.r2.a (+ phase: 0 /partial)

HSP 1 Score: 177.948 bits (450), Expect = 7.177e-46
Identity = 83/119 (69.75%), Postives = 103/119 (86.55%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML AP+  NRPLFAAKD+KPFYLEH PKIF Q++G+    +  +  +L GPKYDGKYLH+VV++KLG+I+L ET+TNVVIPTFDIKT+QP +FSSYQIK++PCL+A+LSDICI
Sbjct:   59 GGLVTAMLCAPNDKNRPLFAAKDVKPFYLEHSPKIFPQNKGLLAS-IGNLFGTLRGPKYDGKYLHKVVKEKLGEIRLRETLTNVVIPTFDIKTMQPTVFSSYQIKRSPCLDAQLSDICI 176          
BLAST of CD858907 vs. Lotus protein
Match: chr1.CM2113.130.r2.a (+ phase: 0 )

HSP 1 Score: 172.17 bits (435), Expect = 3.938e-44
Identity = 79/119 (66.39%), Postives = 102/119 (85.71%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML+AP+   RPLFAAKDIKPFY EH PKIF QH+G+    +  +  +LGGPKYDGKYLH+VV++KLG+ ++++T+TNVVIPTFDIKT+QP +FSSY+IK +PCL+A+L+DICI
Sbjct:   70 GGLVTAMLSAPNDKKRPLFAAKDIKPFYFEHGPKIFPQHKGLLAT-IGNLFGTLGGPKYDGKYLHKVVKEKLGETRVHDTLTNVVIPTFDIKTMQPTVFSSYKIKTSPCLDAQLADICI 187          
BLAST of CD858907 vs. Lotus protein
Match: LjSGA_057889.1 (- phase: 0 )

HSP 1 Score: 68.1662 bits (165), Expect = 8.009e-13
Identity = 30/58 (51.72%), Postives = 44/58 (75.86%), Query Frame = -2
Query:   47 LAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQI 220
            L  ++++L G KY+GKYLH++V++ L D  L++T+T VVIPTFD+   QP IFSS Q+
Sbjct:   73 LINLIKALTGSKYNGKYLHKIVKELLRDTTLSQTLTKVVIPTFDVTKFQPTIFSSNQV 130          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma14g08910.1|PACid:16294886 ()

HSP 1 Score: 209.534 bits (532), Expect = 5.328e-55
Identity = 95/119 (79.83%), Postives = 113/119 (94.96%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAM+ APD NNRPLFAAKDIKPFY++HCPKIF QH G+GG +LAK++RSLGGPKYDGKYLHEVV++KLGDI+L+ET+TNVVIPTFDIK+LQPIIFSSY++K +PC++AKLSDICI
Sbjct:   69 GGLVTAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKMIRSLGGPKYDGKYLHEVVKEKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYKLKISPCMDAKLSDICI 187          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma17g36250.1|PACid:16307222 ()

HSP 1 Score: 201.83 bits (512), Expect = 1.111e-52
Identity = 96/120 (80.00%), Postives = 111/120 (92.50%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSL-GGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAM+ APD NNRPLFAAKDIKPFY++H PKIF QHRG+GG +LAKV++SL GGPKYDGKYLH VVR+KLGDI+L+ET+TNVVIPTFDIK+LQPIIFSSYQ+K +P L+AKLSDICI
Sbjct:   69 GGLVTAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHRGLGGTILAKVVKSLLGGPKYDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQVKNSPSLDAKLSDICI 188          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma04g03970.1|PACid:16254785 ()

HSP 1 Score: 193.356 bits (490), Expect = 3.951e-50
Identity = 90/119 (75.63%), Postives = 108/119 (90.76%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GG+VTAML AP+ N RPLFAAKDIKPFYLEHCPKIF QH G+ G +  K++RSLGGPKY+GKYL EVVR+K+G+ +L+ET+TN+VIPTFDIKTLQPIIFSSYQIK++PCL+A+LSDICI
Sbjct:   59 GGIVTAMLTAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSV-GKLLRSLGGPKYNGKYLQEVVREKVGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICI 176          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma06g04130.1|PACid:16261651 ()

HSP 1 Score: 192.971 bits (489), Expect = 5.161e-50
Identity = 91/119 (76.47%), Postives = 107/119 (89.92%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GG+VTAML+AP+ N RPLFAAKDIKPFYLEHCPKIF QH G+ G +  K++ SLGGPKYDGKYL EVVR+KLG  +L+ET+TN+VIPTFDIKTLQPIIFSSYQIK++PCL+A+LSDICI
Sbjct:   59 GGIVTAMLSAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSV-GKLLGSLGGPKYDGKYLKEVVREKLGQTRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICI 176          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma17g36270.1|PACid:16307224 ()

HSP 1 Score: 166.777 bits (421), Expect = 3.961e-42
Identity = 81/119 (68.07%), Postives = 100/119 (84.03%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML APD+NNRPL+AAKDIK FYL+H PKIF Q+  +   +L K+ R+L GP+Y+GKYLH+++R+KLGD KL++T+TNVVIP FDIK LQP IFSS+Q+KK P LNA LSDICI
Sbjct:   49 GGLVTAMLTAPDENNRPLYAAKDIKDFYLDHTPKIFPQNNNLFSPIL-KLGRTLFGPQYNGKYLHKLIREKLGDTKLHQTLTNVVIPAFDIKHLQPAIFSSFQLKKRPDLNASLSDICI 166          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma14g08920.1|PACid:16294887 ()

HSP 1 Score: 160.614 bits (405), Expect = 2.838e-40
Identity = 79/120 (65.83%), Postives = 97/120 (80.83%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMM-LAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML AP++NNRPL+AAKDIK FYLEH PKIF Q++       + K  R+L GP+Y+GKYLH ++R+KLG+ KL++T+TNVVIP FDIK LQP IFSS+Q+KK P LNA LSDICI
Sbjct:   68 GGLVTAMLTAPNENNRPLYAAKDIKNFYLEHTPKIFPQNKCWNLFSSMVKFTRTLFGPQYNGKYLHRLIREKLGETKLHQTLTNVVIPAFDIKRLQPTIFSSFQLKKRPDLNASLSDICI 187          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma14g08900.1|PACid:16294884 ()

HSP 1 Score: 160.614 bits (405), Expect = 2.838e-40
Identity = 79/120 (65.83%), Postives = 97/120 (80.83%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMM-LAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML AP++NNRPL+AAKDIK FYLEH PKIF Q++       + K  R+L GP+Y+GKYLH ++R+KLG+ KL++T+TNVVIP FDIK LQP IFSS+Q+KK P LNA LSDICI
Sbjct:   68 GGLVTAMLTAPNENNRPLYAAKDIKNFYLEHTPKIFPQNKCWNLFSSMVKFTRTLFGPQYNGKYLHRLIREKLGETKLHQTLTNVVIPAFDIKRLQPTIFSSFQLKKRPDLNASLSDICI 187          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma11g06070.1|PACid:16282852 ()

HSP 1 Score: 149.058 bits (375), Expect = 8.546e-37
Identity = 75/121 (61.98%), Postives = 92/121 (76.03%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQ--NNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLV +MLAAP+   NNRPLFAA +I PFYLE+ P+IF Q RG     L  + ++L GPKYDGK+ HE++R KLG  KL++T+TNVVIPTFD+K LQP IFSSYQ+ K P L+  LSDICI
Sbjct:   67 GGLVASMLAAPNPKANNRPLFAANEIVPFYLENSPQIFPQKRGGIFAPLVNIGKALTGPKYDGKHFHELIRNKLGGTKLHQTLTNVVIPTFDVKILQPTIFSSYQMAKEPTLDVLLSDICI 187          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma17g36260.1|PACid:16307223 ()

HSP 1 Score: 137.502 bits (345), Expect = 2.573e-33
Identity = 66/108 (61.11%), Postives = 88/108 (81.48%), Query Frame = -2
Query:   38 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMM-LAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKT 358
            GGLVTA+L AP++NNRPL+AAKDIK FYL+H PKIF Q++    +  + K+ R+L GP+Y+GKYLH ++R+KLG+ KL++T+TNVVIP FDIK LQP IFSS+Q+  T
Sbjct:   68 GGLVTAILTAPNENNRPLYAAKDIKNFYLDHTPKIFPQNKCWNLLSSMVKLTRTLFGPQYNGKYLHNLIREKLGETKLHQTLTNVVIPGFDIKRLQPTIFSSFQLDPT 175          
BLAST of CD858907 vs. Soybean peptides
Match: Glyma07g13780.1|PACid:16267202 ()

HSP 1 Score: 113.62 bits (283), Expect = 3.979e-26
Identity = 59/121 (48.76%), Postives = 76/121 (62.81%), Query Frame = -2
Query:    2 GGLVTAMLAAP--DQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGL+TAML  P  D    PLF    I  FY ++ P IF +  G           +  GPKYDGK+LH   R+ L D +L++T+TNVVIPTFD+K L P+IFS++Q+K  P  +AKLSDICI
Sbjct:   80 GGLMTAMLTTPHPDDPTHPLFTPSGIIEFYKKYGPSIFNETSGWDN--------AFPGPKYDGKFLHNKARELLQDTRLSQTLTNVVIPTFDLKKLHPVIFSNFQLKTVPSFDAKLSDICI 192          
BLAST of CD858907 vs. SwissProt
Match: PAT05_SOLTU (Patatin-05 OS=Solanum tuberosum GN=pat1-k1 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.908e-27
Identity = 57/118 (48.31%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H P IF    G              GPKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+SDIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIFNSSTG-----------QFFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMSDIC 185          
BLAST of CD858907 vs. SwissProt
Match: PAT13_SOLTU (Patatin-13 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.316e-26
Identity = 57/118 (48.31%), Postives = 79/118 (66.95%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H P IF    G              GPKYDGKYL +V ++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+SDIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIFNSSTG-----------QFFGPKYDGKYLMQVPQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMSDIC 185          
BLAST of CD858907 vs. SwissProt
Match: PAT07_SOLTU (Patatin-07 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.316e-26
Identity = 57/118 (48.31%), Postives = 81/118 (68.64%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY EH P IF                S+ GP+YDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+SDIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIFNYSG------------SIFGPRYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMSDIC 184          
BLAST of CD858907 vs. SwissProt
Match: PAT03_SOLTU (Patatin-03 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.316e-26
Identity = 56/118 (47.46%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H P IF    G              GPKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + ++P L+AK+SDIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIFNSSTG-----------QFFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLARSPELDAKMSDIC 185          
BLAST of CD858907 vs. SwissProt
Match: PATT5_SOLTU (Patatin-T5 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.719e-26
Identity = 59/118 (50.00%), Postives = 82/118 (69.49%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++ NRP  AAKDI PFY EH PKIF Q  G           S+ GPKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNETNRPFAAAKDIVPFYFEHGPKIF-QSSG-----------SIFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 184          
BLAST of CD858907 vs. SwissProt
Match: PAT11_SOLTU (Patatin-11 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.932e-26
Identity = 56/118 (47.46%), Postives = 79/118 (66.95%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H P IF    G              GPKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIFNSSTG-----------QFFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 185          
BLAST of CD858907 vs. SwissProt
Match: PT3K1_SOLTU (Patatin-3-Kuras 1 OS=Solanum tuberosum GN=pat3-k1 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.002e-26
Identity = 58/118 (49.15%), Postives = 81/118 (68.64%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY +H PKIF       G  L +       PKYDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + KTP L+AK+ DIC
Sbjct:   67 GGLLTAMITTPNENNRPFAAAKDIIPFYFDHGPKIFEP----SGFHLVE-------PKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKTPELDAKMYDIC 173          
BLAST of CD858907 vs. SwissProt
Match: PATM3_SOLTU (Patatin group M-3 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.531e-26
Identity = 57/118 (48.31%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFYLEH P IF                S+ GP YDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYLEHGPHIFNYSG------------SIIGPMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 184          
BLAST of CD858907 vs. SwissProt
Match: PATB1_SOLTU (Patatin-B1 OS=Solanum tuberosum GN=PATB1 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 8.531e-26
Identity = 56/118 (47.46%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY EH P IF                S+ GP+YDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIFNYSG------------SIFGPRYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 184          
BLAST of CD858907 vs. SwissProt
Match: PAT15_SOLTU (Patatin-15 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.531e-26
Identity = 56/118 (47.46%), Postives = 80/118 (67.80%), Query Frame = -2
Query:    5 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDIC 358
            GGL+TAM+  P++NNRP  AAKDI PFY EH P IF                S+ GP+YDGKYL +V+++KLG+ ++++ +T V I +FDIKT +P+IF+   + K+P L+AK+ DIC
Sbjct:   79 GGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIFNYSG------------SIFGPRYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDIC 184          
BLAST of CD858907 vs. Medicago proteins
Match: IMGA|Medtr1g019940.1 (Patatin-like protein (AHRD V1 ***- Q29VI1_GOSHI); contains Interpro domain(s) IPR002641 Patatin chr01_pseudomolecule_IMGAG_V3.5 6248446-6244192 F EGN_Mt100125 20100825)

HSP 1 Score: 222.246 bits (565), Expect = 4.890e-59
Identity = 102/119 (85.71%), Postives = 116/119 (97.48%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAMLAAPD+NNRPLFAAKDIKPFYLEHCPKIF QHRG+G  +LAKVMRSLGGPKYDGKYLH+VVR+KLGDI+L+ET+TN+V+PTFDIKTLQPIIFSSYQ+K++PCL+AKLSDICI
Sbjct:   70 GGLVTAMLAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDICI 188          
BLAST of CD858907 vs. Medicago proteins
Match: IMGA|Medtr1g019940.2 (Patatin-like protein (AHRD V1 ***- Q29VI1_GOSHI); contains Interpro domain(s) IPR002641 Patatin chr01_pseudomolecule_IMGAG_V3.5 6248446-6244192 F EGN_Mt100125 20100825)

HSP 1 Score: 214.542 bits (545), Expect = 1.020e-56
Identity = 101/119 (84.87%), Postives = 114/119 (95.80%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAMLAAPD+NNRPLFAAKDIKPFYLEHCPKIF QHRG+G  +LAKVMRSLGGPKYDGKYLH+VVR+KLGDI+L+ET+TN+V+PTFDIKTLQPIIFSSYQ  ++PCL+AKLSDICI
Sbjct:   70 GGLVTAMLAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQ--RSPCLDAKLSDICI 186          
BLAST of CD858907 vs. Medicago proteins
Match: IMGA|Medtr3g101410.1 (Patatin-like protein (AHRD V1 ***- Q29VI1_GOSHI); contains Interpro domain(s) IPR002641 Patatin chr03_pseudomolecule_IMGAG_V3.5 35737893-35739841 E EGN_Mt100125 20100825)

HSP 1 Score: 185.267 bits (469), Expect = 6.625e-48
Identity = 88/119 (73.95%), Postives = 105/119 (88.24%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML+AP+   RPLFAAKDIKPFYLEH PKIF Q + + G    K+ RSL GPKYDGKYLHEVVR+KLG+I+++ET+TN+VIPTFDIKT+QPIIFSSY+IKKTPC++A+LSDICI
Sbjct:   69 GGLVTAMLSAPNDKKRPLFAAKDIKPFYLEHSPKIFPQQKDLFGSF-GKLFRSLVGPKYDGKYLHEVVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKIKKTPCMDARLSDICI 186          
BLAST of CD858907 vs. Medicago proteins
Match: IMGA|Medtr3g101400.1 (Patatin-like protein (AHRD V1 ***- Q29VI1_GOSHI); contains Interpro domain(s) IPR002641 Patatin chr03_pseudomolecule_IMGAG_V3.5 35733833-35735883 E EGN_Mt100125 20100825)

HSP 1 Score: 179.104 bits (453), Expect = 4.748e-46
Identity = 84/119 (70.59%), Postives = 102/119 (85.71%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGLVTAML+AP+   RPLFAAKDIKPFYLEHCPKIF Q + + G +  K+ +SL GPKYDG YLH VVR+KLG+I+++ET+TN+VIPTFDIKT QPIIFSSY+IK  PC++A+LSDICI
Sbjct:   69 GGLVTAMLSAPNDKQRPLFAAKDIKPFYLEHCPKIFPQQKHMLGSV-GKLFKSLAGPKYDGNYLHSVVREKLGEIRVHETLTNIVIPTFDIKTSQPIIFSSYKIKNAPCMDARLSDICI 186          
BLAST of CD858907 vs. Medicago proteins
Match: IMGA|Medtr5g017680.1 (Patatin-like protein 1 (AHRD V1 ***- Q9FZ09_TOBAC); contains Interpro domain(s) IPR002641 Patatin chr05_pseudomolecule_IMGAG_V3.5 6252600-6250024 E EGN_Mt100125 20100825)

HSP 1 Score: 133.265 bits (334), Expect = 2.988e-32
Identity = 66/121 (54.55%), Postives = 90/121 (74.38%), Query Frame = -2
Query:    2 GGLVTAMLAAPDQ--NNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGL+T MLA P++  NNRPLFAAK+I PFYL++ P IF Q  GI   +++   ++L G KY+G+YLH+++R    D  L++T+TNVVIP+FD++ LQP IFSSYQI+  P L+  LSDICI
Sbjct:   59 GGLITTMLATPNRKANNRPLFAAKEIVPFYLQNLPNIFPQQSGIFAPLISTT-KALTGSKYNGEYLHKLIRNMTQDTLLSQTLTNVVIPSFDVQKLQPTIFSSYQIEAEPALDVLLSDICI 178          
BLAST of CD858907 vs. Medicago proteins
Match: IMGA|Medtr5g017670.1 (Patatin-like protein 1 (AHRD V1 ***- Q9FZ09_TOBAC); contains Interpro domain(s) IPR002641 Patatin chr05_pseudomolecule_IMGAG_V3.5 6249686-6244087 E EGN_Mt100125 20100825)

HSP 1 Score: 131.724 bits (330), Expect = 8.693e-32
Identity = 64/120 (53.33%), Postives = 90/120 (75.00%), Query Frame = -2
Query:    2 GGLVTAMLAAPD-QNNRPLFAAKDIKPFYLEHCPKIFTQHRGIGGMMLAKVMRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 358
            GGL+T MLAAP+ ++NRPLFAAK+I PFYL++ P IF Q  GI   ++  + ++L G KY+G+YLH+++R    D  L++T+TN+VIP+FD++ LQP IFSSYQI   P L+  L+DICI
Sbjct:   65 GGLITTMLAAPNPKDNRPLFAAKEIVPFYLQNLPSIFPQKSGIFAPLI-NITKALTGAKYNGEYLHKLIRNMTKDTLLSQTLTNIVIPSFDVQNLQPTIFSSYQIDAEPTLDVPLADICI 183          
BLAST of CD858907 vs. Medicago proteins
Match: IMGA|Medtr1g019940.3 (Patatin-like protein 1 (AHRD V1 ***- Q9FZ09_TOBAC); contains Interpro domain(s) IPR002641 Patatin chr01_pseudomolecule_IMGAG_V3.5 6248446-6244192 F EGN_Mt100125 20100825)

HSP 1 Score: 130.183 bits (326), Expect = 2.529e-31
Identity = 58/69 (84.06%), Postives = 69/69 (100.00%), Query Frame = -2
Query:    2 MRSLGGPKYDGKYLHEVVRQKLGDIKLNETITNVVIPTFDIKTLQPIIFSSYQIKKTPCLNAKLSDICI 208
            MRSLGGPKYDGKYLH+VVR+KLGDI+L+ET+TN+V+PTFDIKTLQPIIFSSYQ+K++PCL+AKLSDICI
Sbjct:    1 MRSLGGPKYDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDICI 69          
The following BLAST results are available for this feature:
Homology Analysis: Pisum sativum unigene v1 vs Trembl
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6TM65_SOYBN6.927e-5080.00Putative uncharacterized protein (Fragment) OS=Gly... [more]
B9R7G5_RICCO1.309e-4068.07Patatin T5, putative OS=Ricinus communis GN=RCOM_1... [more]
B9R7G2_RICCO3.810e-4064.71Patatin, putative OS=Ricinus communis GN=RCOM_1591... [more]
Q9FZ09_TOBAC8.488e-4066.39Patatin-like protein 1 OS=Nicotiana tabacum GN=PAT... [more]
A5C9Q5_VITVI1.109e-3965.55Putative uncharacterized protein OS=Vitis vinifera... [more]
B9R7G7_RICCO1.891e-3965.55Patatin T5, putative OS=Ricinus communis GN=RCOM_1... [more]
B9R7G6_RICCO1.891e-3963.87Patatin T5, putative OS=Ricinus communis GN=RCOM_1... [more]
Q9AQT8_VIGUN9.384e-3969.17Patatin-like protein OS=Vigna unguiculata PE=2 SV=... [more]
B9R7G4_RICCO2.730e-3864.71Patatin T5, putative OS=Ricinus communis GN=RCOM_1... [more]
A5AUQ2_VITVI2.730e-3865.00Putative uncharacterized protein (Fragment) OS=Vit... [more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs Swissprot
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
PAT05_SOLTU5.805e-2748.31Patatin-05 OS=Solanum tuberosum GN=pat1-k1 PE=1 SV... [more]
PAT13_SOLTU1.293e-2648.31Patatin-13 OS=Solanum tuberosum PE=2 SV=1[more]
PAT07_SOLTU1.293e-2648.31Patatin-07 OS=Solanum tuberosum PE=2 SV=1[more]
PAT03_SOLTU1.293e-2647.46Patatin-03 OS=Solanum tuberosum PE=2 SV=1[more]
PATT5_SOLTU1.689e-2650.00Patatin-T5 OS=Solanum tuberosum PE=1 SV=1[more]
PAT11_SOLTU2.881e-2647.46Patatin-11 OS=Solanum tuberosum PE=2 SV=1[more]
PT3K1_SOLTU4.914e-2649.15Patatin-3-Kuras 1 OS=Solanum tuberosum GN=pat3-k1 ... [more]
PATM3_SOLTU8.382e-2648.31Patatin group M-3 OS=Solanum tuberosum PE=2 SV=1[more]
PATB1_SOLTU8.382e-2647.46Patatin-B1 OS=Solanum tuberosum GN=PATB1 PE=2 SV=2[more]
PAT15_SOLTU8.382e-2647.46Patatin-15 OS=Solanum tuberosum PE=2 SV=1[more]
back to top
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT4G37060.24.936e-3863.87| Symbols: PLP5 | PATATIN-like protein 5 | chr4:17... [more]
AT4G37060.14.936e-3863.87| Symbols: PLP5, PLA IVB, AtPLAIVB | PATATIN-like ... [more]
AT4G37070.42.450e-3761.34| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transfer... [more]
AT4G37070.12.450e-3761.34| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transfer... [more]
AT4G37070.32.450e-3761.34| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transfer... [more]
AT4G37070.22.450e-3761.34| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transfer... [more]
AT2G26560.15.458e-3762.18| Symbols: PLP2, PLA IIA, PLA2A | phospholipase A ... [more]
AT4G37050.11.344e-3558.73| Symbols: PLP4, PLA V, AtPLAIVC | PATATIN-like pr... [more]
AT5G43590.14.048e-3258.82| Symbols: | Acyl transferase/acyl hydrolase/lyso... [more]
AT3G54950.13.334e-1028.81| Symbols: PLP7, PLA IIIA | patatin-like protein 6... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT4G37060.24.936e-3863.87| Symbols: PLP5 | PATATIN-like protein 5 | chr4:17... [more]
AT4G37060.14.936e-3863.87| Symbols: PLP5, PLA IVB, AtPLAIVB | PATATIN-like ... [more]
AT4G37070.42.450e-3761.34| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transfer... [more]
AT4G37070.12.450e-3761.34| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transfer... [more]
AT4G37070.32.450e-3761.34| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transfer... [more]
AT4G37070.22.450e-3761.34| Symbols: PLP1, PLA IVA, AtPLAIVA | Acyl transfer... [more]
AT2G26560.15.458e-3762.18| Symbols: PLP2, PLA IIA, PLA2A | phospholipase A ... [more]
AT4G37050.11.344e-3558.73| Symbols: PLP4, PLA V, AtPLAIVC | PATATIN-like pr... [more]
AT5G43590.14.048e-3258.82| Symbols: | Acyl transferase/acyl hydrolase/lyso... [more]
AT3G54950.13.334e-1028.81| Symbols: PLP7, PLA IIIA | patatin-like protein 6... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Trembl
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6TM65_SOYBN8.663e-5080.00Putative uncharacterized protein (Fragment) OS=Gly... [more]
E0CPA0_VITVI9.600e-4166.39Whole genome shotgun sequence of line PN40024, sca... [more]
E0CP99_VITVI9.600e-4166.39Whole genome shotgun sequence of line PN40024, sca... [more]
B9R7G5_RICCO1.637e-4068.07Patatin T5, putative OS=Ricinus communis GN=RCOM_1... [more]
B9R7G2_RICCO4.764e-4064.71Patatin, putative OS=Ricinus communis GN=RCOM_1591... [more]
Q9FZ09_TOBAC1.061e-3966.39Patatin-like protein 1 OS=Nicotiana tabacum GN=PAT... [more]
E0CPA3_VITVI1.061e-3966.39Whole genome shotgun sequence of line PN40024, sca... [more]
E0CPA1_VITVI1.061e-3965.55Whole genome shotgun sequence of line PN40024, sca... [more]
A5C9Q5_VITVI1.386e-3965.55Putative uncharacterized protein OS=Vitis vinifera... [more]
B9R7G7_RICCO2.365e-3965.55Patatin T5, putative OS=Ricinus communis GN=RCOM_1... [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 5
Match NameE-valueIdentityDescription
chr1.CM2113.140.r2.m2.467e-4669.75+ phase: 0 [more]
chr1.CM2113.20.r2.a5.495e-4668.91- phase: 0 [more]
chr1.CM2113.100.r2.a7.177e-4669.75+ phase: 0 /partial[more]
chr1.CM2113.130.r2.a3.938e-4466.39+ phase: 0 [more]
LjSGA_057889.18.009e-1351.72- phase: 0 [more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 10
Match NameE-valueIdentityDescription
Glyma14g08910.1|PACid:162948865.328e-5579.83[more]
Glyma17g36250.1|PACid:163072221.111e-5280.00[more]
Glyma04g03970.1|PACid:162547853.951e-5075.63[more]
Glyma06g04130.1|PACid:162616515.161e-5076.47[more]
Glyma17g36270.1|PACid:163072243.961e-4268.07[more]
Glyma14g08920.1|PACid:162948872.838e-4065.83[more]
Glyma14g08900.1|PACid:162948842.838e-4065.83[more]
Glyma11g06070.1|PACid:162828528.546e-3761.98[more]
Glyma17g36260.1|PACid:163072232.573e-3361.11[more]
Glyma07g13780.1|PACid:162672023.979e-2648.76[more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Swissprot
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
PAT05_SOLTU5.908e-2748.31Patatin-05 OS=Solanum tuberosum GN=pat1-k1 PE=1 SV... [more]
PAT13_SOLTU1.316e-2648.31Patatin-13 OS=Solanum tuberosum PE=2 SV=1[more]
PAT07_SOLTU1.316e-2648.31Patatin-07 OS=Solanum tuberosum PE=2 SV=1[more]
PAT03_SOLTU1.316e-2647.46Patatin-03 OS=Solanum tuberosum PE=2 SV=1[more]
PATT5_SOLTU1.719e-2650.00Patatin-T5 OS=Solanum tuberosum PE=1 SV=1[more]
PAT11_SOLTU2.932e-2647.46Patatin-11 OS=Solanum tuberosum PE=2 SV=1[more]
PT3K1_SOLTU5.002e-2649.15Patatin-3-Kuras 1 OS=Solanum tuberosum GN=pat3-k1 ... [more]
PATM3_SOLTU8.531e-2648.31Patatin group M-3 OS=Solanum tuberosum PE=2 SV=1[more]
PATB1_SOLTU8.531e-2647.46Patatin-B1 OS=Solanum tuberosum GN=PATB1 PE=2 SV=2[more]
PAT15_SOLTU8.531e-2647.46Patatin-15 OS=Solanum tuberosum PE=2 SV=1[more]
back to top
Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 7
Match NameE-valueIdentityDescription
IMGA|Medtr1g019940.14.890e-5985.71Patatin-like protein (AHRD V1 ***- Q29VI1_GOSHI); ... [more]
IMGA|Medtr1g019940.21.020e-5684.87Patatin-like protein (AHRD V1 ***- Q29VI1_GOSHI); ... [more]
IMGA|Medtr3g101410.16.625e-4873.95Patatin-like protein (AHRD V1 ***- Q29VI1_GOSHI); ... [more]
IMGA|Medtr3g101400.14.748e-4670.59Patatin-like protein (AHRD V1 ***- Q29VI1_GOSHI); ... [more]
IMGA|Medtr5g017680.12.988e-3254.55Patatin-like protein 1 (AHRD V1 ***- Q9FZ09_TOBAC)... [more]
IMGA|Medtr5g017670.18.693e-3253.33Patatin-like protein 1 (AHRD V1 ***- Q9FZ09_TOBAC)... [more]
IMGA|Medtr1g019940.32.529e-3184.06Patatin-like protein 1 (AHRD V1 ***- Q9FZ09_TOBAC)... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 36..48
score
NoneNo IPR availableGENE3D3.40.1090.10no descriptioncoord: 1..119
score: 2.4
IPR016035Acyl transferase/acyl hydrolase/lysophospholipaseSUPERFAMILY52151FabD/lysophospholipase-likecoord: 1..119
score: 1.3

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 36..48
score
NoneNo IPR availableGENE3D3.40.1090.10no descriptioncoord: 1..119
score: 2.4
IPR016035Acyl transferase/acyl hydrolase/lysophospholipaseSUPERFAMILY52151FabD/lysophospholipase-likecoord: 1..119
score: 1.3

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD858907 ID=CD858907|Name=CD858907|organism=Pisum sativum|type=EST|length=359bp
TAATGCATATGTCCGATAGTTTCGCATTCAAACAAGGAGTTTTCTTAATC
TGATAAGATGAGAAAATAATTGGTTGCAAAGTCTTGATATCAAATGTGGG
AATAACAACGTTGGTGATGGTTTCATTCAACTTTATGTCACCAAGTTTCT
GTCTTACAACTTCATGAAGATATTTTCCATCATATTTAGGTCCTCCAAGA
GATCTCATTACCTTTGCTAACATCATCCCACCTATGCCTCTATGTTGTGT
GAATATTTTTGGGCAGTGTTCAAGGTAGAAGGGTTTGATATCTTTGGCAG
CAAAAAGTGGACGATTGTTTTGATCCGGAGCAGCTAACATGGCCGTAACA
AGACCACCT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR016035Acyl_Trfase/lysoPLipase