GH720453

EST Overview
NameGH720453
Unique NameGH720453
TypeEST
OrganismPisum sativum (pea)
Sequence length228
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide2011-02-03
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_024271 552NIcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720453 vs. TrEMBL
Match: D7SQ86_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_52.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00029178001 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 6.492e-8
Identity = 26/34 (76.47%), Postives = 32/34 (94.12%), Query Frame = -1
Query:  109 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRKP 210
            YP+VEE+D++ FEVLTIFHPT++VINSVVL RKP
Sbjct:  125 YPVVEEEDLLGFEVLTIFHPTNEVINSVVLARKP 158          
BLAST of GH720453 vs. TrEMBL
Match: A5BHX9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_039081 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 6.492e-8
Identity = 26/34 (76.47%), Postives = 32/34 (94.12%), Query Frame = -1
Query:  109 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRKP 210
            YP+VEE+D++ FEVLTIFHPT++VINSVVL RKP
Sbjct:  249 YPVVEEEDLLGFEVLTIFHPTNEVINSVVLARKP 282          
BLAST of GH720453 vs. TrEMBL
Match: B9MYP7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_921907 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 8.479e-8
Identity = 26/34 (76.47%), Postives = 32/34 (94.12%), Query Frame = -1
Query:  109 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRKP 210
            YP+VEE D++ FE+L+IFHPT+DVINSVVLLRKP
Sbjct:  249 YPVVEEQDVLGFELLSIFHPTNDVINSVVLLRKP 282          
BLAST of GH720453 vs. TrEMBL
Match: B9T549_RICCO (Nicotianamine synthase, putative OS=Ricinus communis GN=RCOM_0289180 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.178e-7
Identity = 23/35 (65.71%), Postives = 32/35 (91.43%), Query Frame = -1
Query:  106 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRKPN 210
            YP++++ D+V F+VL+IFHPT+DVINSVVL RKP+
Sbjct:  108 YPVIDDKDLVGFDVLSIFHPTNDVINSVVLARKPS 142          
BLAST of GH720453 vs. TrEMBL
Match: B9T548_RICCO (Nicotianamine synthase, putative OS=Ricinus communis GN=RCOM_0289070 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 9.374e-7
Identity = 22/35 (62.86%), Postives = 32/35 (91.43%), Query Frame = -1
Query:  106 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRKPN 210
            YP++++ D+V F+VL+IFHPT+DVINSV+L RKP+
Sbjct:  284 YPVIDDKDLVGFDVLSIFHPTNDVINSVILARKPS 318          
BLAST of GH720453 vs. TAIR peptide
Match: AT5G04950.1 (| Symbols: NAS1, ATNAS1 | nicotianamine synthase 1 | chr5:1457876-1458838 REVERSE LENGTH=320)

HSP 1 Score: 51.9878 bits (123), Expect = 8.907e-8
Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = -1
Query:  112 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRK 210
            YPIV+  D+  F++LTI+HPTDDV+NSVV+ RK
Sbjct:  243 YPIVDSSDLKGFQLLTIYHPTDDVVNSVVIARK 275          
BLAST of GH720453 vs. TAIR peptide
Match: AT5G56080.1 (| Symbols: ATNAS2, NAS2 | nicotianamine synthase 2 | chr5:22711402-22712364 REVERSE LENGTH=320)

HSP 1 Score: 51.6026 bits (122), Expect = 1.163e-7
Identity = 22/33 (66.67%), Postives = 28/33 (84.85%), Query Frame = -1
Query:  112 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRK 210
            YPIV+  D+  FEVLTI+HP+DDV+NSVV+ RK
Sbjct:  242 YPIVDSCDLKGFEVLTIYHPSDDVVNSVVIARK 274          
BLAST of GH720453 vs. TAIR peptide
Match: AT1G09240.1 (| Symbols: NAS3, ATNAS3 | nicotianamine synthase 3 | chr1:2984950-2985912 FORWARD LENGTH=320)

HSP 1 Score: 51.2174 bits (121), Expect = 1.519e-7
Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = -1
Query:  112 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRK 210
            YPIVE  D+  FEVL+I+HPTDDVINSVV+ +K
Sbjct:  242 YPIVEPCDLQGFEVLSIYHPTDDVINSVVISKK 274          
BLAST of GH720453 vs. TAIR peptide
Match: AT1G56430.1 (| Symbols: ATNAS4, NAS4 | nicotianamine synthase 4 | chr1:21137023-21137997 FORWARD LENGTH=324)

HSP 1 Score: 50.0618 bits (118), Expect = 3.385e-7
Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = -1
Query:  112 YPIVEEDDMVNFEVLTIFHPTDDVINSVVLLRK 210
            YPIVE  D+  FEVL+++HPTD+VINS+V+ RK
Sbjct:  243 YPIVEPCDLEGFEVLSVYHPTDEVINSIVISRK 275          
The following BLAST results are available for this feature:
BLAST of GH720453 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 5
Match NameE-valueIdentityDescription
D7SQ86_VITVI6.492e-876.47Whole genome shotgun sequence of line PN40024, sca... [more]
A5BHX9_VITVI6.492e-876.47Putative uncharacterized protein OS=Vitis vinifera... [more]
B9MYP7_POPTR8.479e-876.47Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9T549_RICCO7.178e-765.71Nicotianamine synthase, putative OS=Ricinus commun... [more]
B9T548_RICCO9.374e-762.86Nicotianamine synthase, putative OS=Ricinus commun... [more]
back to top
BLAST of GH720453 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 4
Match NameE-valueIdentityDescription
AT5G04950.18.907e-863.64| Symbols: NAS1, ATNAS1 | nicotianamine synthase 1... [more]
AT5G56080.11.163e-766.67| Symbols: ATNAS2, NAS2 | nicotianamine synthase 2... [more]
AT1G09240.11.519e-769.70| Symbols: NAS3, ATNAS3 | nicotianamine synthase 3... [more]
AT1G56430.13.385e-763.64| Symbols: ATNAS4, NAS4 | nicotianamine synthase 4... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 54..68
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720453 ID=GH720453|Name=GH720453|organism=Pisum sativum|type=EST|length=228bp
TTCGAGCGGCCGCCCGNGGCAGGTACATAACAACCCACATTTGAACATAA
AACTATATAGTAAATATCCAACTTATTTGGTAAATGAGAGACCAATGAAT
CAAGCATTAGGCTTACGAAGAAGAACAACCGAGTTAATCACATCATCAGT
TGGATGGAAGATAGTAAGCACTTCAAAATTCACCATATCATCTTCTTCAA
CAATAGGGTACCTCGGCCGCGACCACGC
back to top