GH720207
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GH720207 vs. Medicago proteins
Match: IMGA|Medtr3g117020.1 (Unknown Protein (AHRD V1) chr03_pseudomolecule_IMGAG_V3.5 42482202-42482602 E EGN_Mt100125 20100825) HSP 1 Score: 53.9138 bits (128), Expect = 2.320e-8 Identity = 37/84 (44.05%), Postives = 45/84 (53.57%), Query Frame = -2 Query: 8 AKTTASLVLLVICMAL-ILNGYSAVEGARSGNQMKRDE-----ARSNKYHVTTTDNPGFGYGLPRIGICLKLHKLCLLNPTKYC 241 AKTTAS VL+V + L ILNGYSAVEG GNQ ++DE +RS+ Y C KL KLCL +P+ C Sbjct: 2 AKTTASFVLVVFVVTLLILNGYSAVEGEGRGNQHEKDEVGGYNSRSHLYE------------------CYKLLKLCLRDPSNNC 67
BLAST of GH720207 vs. Medicago proteins
Match: IMGA|Medtr8g012150.1 (Unknown Protein (AHRD V1) chr08_pseudomolecule_IMGAG_V3.5 2238556-2238849 H EGN_Mt100125 20100825) HSP 1 Score: 49.2914 bits (116), Expect = 5.714e-7 Identity = 32/75 (42.67%), Postives = 46/75 (61.33%), Query Frame = -2 Query: 20 KTTASLVLLVICMALILNGYSAVEGARSGNQMKRDEA--RSNKYHVTTTDNPGFGYGLPRIGICLKLHKLCLLNP 238 KT ASLVL+ + +A++LNGY+A +G R GNQ+K+D+A +S K FG L C L+ +CL+NP Sbjct: 3 KTIASLVLVSLVVAILLNGYNAEDGGR-GNQLKKDDAIYKSQK----------FGQCLD----CTILYNICLVNP 62 The following BLAST results are available for this feature:
BLAST of GH720207 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GH720207 ID=GH720207; Name=GH720207; organism=Pisum sativum; type=EST; length=260bpback to top |