CD860223

EST Overview
NameCD860223
Unique NameCD860223
TypeEST
OrganismPisum sativum (pea)
Sequence length620
Libraries
Library NameType
LIBEST_014002 PWcdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of CD860223 vs. TrEMBL
Match: Q9XFK0_PEA (G protein beta subunit OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 6.356e-101
Identity = 163/167 (97.60%), Postives = 163/167 (97.60%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSP DRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVF GEFQSGHTA
Sbjct:   39 YARSQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPLDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFLGEFQSGHTA 205          

HSP 2 Score: 51.2174 bits (121), Expect = 6.356e-101
Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSVA++KERHIAATETVNNLRERL + RLS
Sbjct:    1 MSVADVKERHIAATETVNNLRERLSRDRLS 30          
BLAST of CD860223 vs. TrEMBL
Match: C6THC3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 3.134e-100
Identity = 158/167 (94.61%), Postives = 162/167 (97.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGR+PVTFGPTD++CCRTLQGH GKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCS+FNLNSPTDRDGNL VSRMLSGHKGYVSSCQYVP EDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGRSPVTFGPTDLVCCRTLQGHAGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSLFNLNSPTDRDGNLAVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 54.299 bits (129), Expect = 3.134e-100
Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSV ELKERH+AATETVN+LRERLK+RRLS
Sbjct:    1 MSVTELKERHLAATETVNSLRERLKERRLS 30          
BLAST of CD860223 vs. TrEMBL
Match: D7TQ08_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_63.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00031958001 PE=4 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.089e-97
Identity = 152/167 (91.02%), Postives = 162/167 (97.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  +QG++PVTFGPTD++CCRTLQGHTGKVYSLDWT+EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSPTD+DGNL +S+MLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARAQGKSPVTFGPTDLVCCRTLQGHTGKVYSLDWTTEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPTDKDGNLAMSKMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 53.9138 bits (128), Expect = 1.089e-97
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSVAELKERH+AATETVN+LRERLKQ+RL
Sbjct:    1 MSVAELKERHMAATETVNSLRERLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: B9H0Q0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_712950 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 7.004e-97
Identity = 152/167 (91.02%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  +Q R+PV+FGPTD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTD+DGNL VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTG+RTSVFGGEFQSGHTA
Sbjct:   39 YARAQERSPVSFGPTDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGIRTSVFGGEFQSGHTA 205          

HSP 2 Score: 53.5286 bits (127), Expect = 7.004e-97
Identity = 25/29 (86.21%), Postives = 29/29 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV+ELKERH+AATETVN+LRERLKQ+RL
Sbjct:    1 MSVSELKERHVAATETVNSLRERLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: B9RBE4_RICCO (Guanine nucleotide-binding protein beta, putative OS=Ricinus communis GN=RCOM_1674940 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.555e-96
Identity = 151/167 (90.42%), Postives = 161/167 (96.41%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  +QG+ PV+FGPTD++CCRTLQGHTGKVYSLDWT+EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPT++DGNL VS+MLSGHKGYVS+CQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARAQGKTPVSFGPTDLVCCRTLQGHTGKVYSLDWTAEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTEKDGNLPVSKMLSGHKGYVSACQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 51.9878 bits (123), Expect = 1.555e-96
Identity = 25/29 (86.21%), Postives = 27/29 (93.10%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSVAELK RH+AATETVN LRERLKQ+RL
Sbjct:    1 MSVAELKARHVAATETVNTLRERLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: B9HRN9_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_722050 PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 5.878e-96
Identity = 152/164 (92.68%), Postives = 157/164 (95.73%), Query Frame = 3
Query:  129 SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            +QGR PV+FGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIFNLNSPTD+DGNL VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   42 AQGRNPVSFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPAGQSVACGGLDSVCSIFNLNSPTDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 50.8322 bits (120), Expect = 5.878e-96
Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV+ELKERH+AATETVN+L ERLKQ+RL
Sbjct:    1 MSVSELKERHVAATETVNSLGERLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: Q9FV61_TOBAC (Heterotrimeric GTP-binding protein subunit beta 1 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 4.932e-95
Identity = 152/167 (91.02%), Postives = 157/167 (94.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 50.0618 bits (118), Expect = 4.932e-95
Identity = 23/29 (79.31%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVTELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: Q9SW94_PEA (G protein beta subunit OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.641e-94
Identity = 168/180 (93.33%), Postives = 169/180 (93.89%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR +       A Y  SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   26 QRRLSLLDTDIAGYARSQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 59.6918 bits (143), Expect = 1.989e-7
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSVAELKERHIAATETVNNLRERLKQRRLS
Sbjct:    1 MSVAELKERHIAATETVNNLRERLKQRRLS 30          
BLAST of CD860223 vs. TrEMBL
Match: C5MTW2_NICBE (Heterotrimeric G protein beta 2 subunit OS=Nicotiana benthamiana PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 5.398e-94
Identity = 152/167 (91.02%), Postives = 157/167 (94.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 46.595 bits (109), Expect = 5.398e-94
Identity = 22/29 (75.86%), Postives = 27/29 (93.10%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+L E+LKQ+RL
Sbjct:    1 MSVKELKERHMAATQTVNDLCEKLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: Q8LJQ7_PEA (G protein beta subunit OS=Pisum sativum PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 8.146e-94
Identity = 167/180 (92.78%), Postives = 168/180 (93.33%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR +       A Y  SQGRAPVT GPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   26 QRRLSLLDTDIAGYARSQGRAPVTLGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 57.3806 bits (137), Expect = 9.871e-7
Identity = 28/30 (93.33%), Postives = 30/30 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSVA++KERHIAATETVNNLRERLKQRRLS
Sbjct:    1 MSVADVKERHIAATETVNNLRERLKQRRLS 30          
BLAST of CD860223 vs. SwissProt
Match: GBB1_TOBAC (Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 3.475e-96
Identity = 152/167 (91.02%), Postives = 157/167 (94.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 50.0618 bits (118), Expect = 3.475e-96
Identity = 23/29 (79.31%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVTELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB3_TOBAC (Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.916e-95
Identity = 151/167 (90.42%), Postives = 157/167 (94.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSI+NLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIYNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 48.1358 bits (113), Expect = 2.916e-95
Identity = 22/29 (75.86%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TV++LRE+LKQ+RL
Sbjct:    1 MSVTELKERHMAATQTVSDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB2_TOBAC (Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 4.962e-95
Identity = 150/167 (89.82%), Postives = 156/167 (93.41%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PV FGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTH+IT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVIFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHVITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 49.6766 bits (117), Expect = 4.962e-95
Identity = 23/29 (79.31%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVKELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_NICPL (Guanine nucleotide-binding protein subunit beta OS=Nicotiana plumbaginifolia PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 6.474e-95
Identity = 150/167 (89.82%), Postives = 155/167 (92.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+G SVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQ GHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGHSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQFGHTA 205          

HSP 2 Score: 50.0618 bits (118), Expect = 6.474e-95
Identity = 23/29 (79.31%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVTELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_SOLTU (Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.102e-94
Identity = 149/167 (89.22%), Postives = 155/167 (92.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y   QG++PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDS CSIFNLNSP D+DG   VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YAKRQGKSPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 51.6026 bits (122), Expect = 1.102e-94
Identity = 24/29 (82.76%), Postives = 29/29 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSVAELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVAELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_ORYSJ (Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. japonica GN=Os03g0669200 PE=1 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.895e-85
Identity = 135/167 (80.84%), Postives = 148/167 (88.62%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  +QGR PV+F PTD++CCRTLQGH+GKVYSLDWT EKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQSVACGGLDS CSIFNLNS  DRDGN+ VSR+L+GHKGYVSSCQYVP ++T LIT SGDQTCVLWD+TTG R S+FGGEF SGHTA
Sbjct:   40 YSRTQGRTPVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQSVACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTCVLWDVTTGQRISIFGGEFPSGHTA 206          

HSP 2 Score: 44.669 bits (104), Expect = 1.895e-85
Identity = 21/27 (77.78%), Postives = 25/27 (92.59%), Query Frame = 1
Query:   25 SVAELKERHIAATETVNNLRERLKQRR 105
            SVAELKE+H AAT +VN+LRERL+QRR
Sbjct:    3 SVAELKEKHAAATASVNSLRERLRQRR 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_MAIZE (Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 3.224e-85
Identity = 135/167 (80.84%), Postives = 147/167 (88.02%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGR PV+F PTD++CCRTLQGH+GKVYSLDWT EKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQSVACGGLDS CSIFNLNS  DRDGN+ VSR+L+GHKGYVSSCQYVP ++T LIT SGDQTCVLWD+TTG R S+FGGEF SGHTA
Sbjct:   40 YSKSQGRVPVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMACAFAPNGQSVACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTCVLWDVTTGQRISIFGGEFPSGHTA 206          

HSP 2 Score: 44.669 bits (104), Expect = 3.224e-85
Identity = 21/27 (77.78%), Postives = 25/27 (92.59%), Query Frame = 1
Query:   25 SVAELKERHIAATETVNNLRERLKQRR 105
            SVAELKE+H AAT +VN+LRERL+QRR
Sbjct:    3 SVAELKEKHAAATASVNSLRERLRQRR 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_ARATH (Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.243e-81
Identity = 141/180 (78.33%), Postives = 157/180 (87.22%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR ++      A Y  +QGR  V+FG TD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:   26 QRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 205          
BLAST of CD860223 vs. SwissProt
Match: GBB1_DANRE (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.779e-41
Identity = 73/139 (52.52%), Postives = 105/139 (75.54%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGG 596
            RTL+GH  K+Y++ W ++   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI+NL +   R+GN+ VSR L+GH GY+S C+++  +D  ++T SGD TC LWDI TG +T+ F G
Sbjct:   49 RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGDTTCALWDIETGQQTTTFAG 182          
BLAST of CD860223 vs. SwissProt
Match: GBB1_RAT (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4)

HSP 1 Score: 166.777 bits (421), Expect = 8.151e-41
Identity = 73/139 (52.52%), Postives = 105/139 (75.54%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGG 596
            RTL+GH  K+Y++ W ++   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI+NL +   R+GN+ VSR L+GH GY+S C+++  +D  ++T SGD TC LWDI TG +T+ F G
Sbjct:   49 RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGDTTCALWDIETGQQTTTFTG 182          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G34460.4 (| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protein beta 1 | chr4:16477393-16479266 REVERSE LENGTH=372)

HSP 1 Score: 300.056 bits (767), Expect = 3.974e-90
Identity = 137/164 (83.54%), Postives = 151/164 (92.07%), Query Frame = 3
Query:  129 SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            +QGR  V+FG TD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:   37 AQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 200          

HSP 2 Score: 49.6766 bits (117), Expect = 3.974e-90
Identity = 23/29 (79.31%), Postives = 27/29 (93.10%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV+ELKERH  ATETVNNLR++L+QRRL
Sbjct:    1 MSVSELKERHAVATETVNNLRDQLRQRRL 29          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G34460.1 (| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protein beta 1 | chr4:16477393-16479266 REVERSE LENGTH=377)

HSP 1 Score: 302.368 bits (773), Expect = 1.289e-82
Identity = 141/180 (78.33%), Postives = 157/180 (87.22%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR ++      A Y  +QGR  V+FG TD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:   26 QRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 205          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G34460.3 (| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protein beta 1 | chr4:16477586-16479266 REVERSE LENGTH=347)

HSP 1 Score: 302.368 bits (773), Expect = 1.289e-82
Identity = 141/180 (78.33%), Postives = 157/180 (87.22%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR ++      A Y  +QGR  V+FG TD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:   26 QRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 205          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G34460.2 (| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protein beta 1 | chr4:16477393-16478769 REVERSE LENGTH=315)

HSP 1 Score: 257.299 bits (656), Expect = 4.755e-69
Identity = 118/139 (84.89%), Postives = 129/139 (92.81%), Query Frame = 3
Query:  204 KVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            +VYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:    5 QVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 143          
BLAST of CD860223 vs. TAIR peptide
Match: AT2G16780.1 (| Symbols: MSI2, MSI02, NFC02, NFC2 | Transducin family protein / WD-40 repeat family protein | chr2:7281615-7283583 REVERSE LENGTH=415)

HSP 1 Score: 60.4622 bits (145), Expect = 8.531e-10
Identity = 36/130 (27.69%), Postives = 65/130 (50.00%), Query Frame = 3
Query:  189 QGHTGKVYSLDW-TSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV-ACGGLDSVCSIFN---LNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDI 563
            +GH   +  + W    +N   SA +DGRL++W+  T+Q  H +K+    V   +F+P  + V A    DS  ++F+   LN+P           ++S H+G V   ++ P  +T L +   D+  ++WD+
Sbjct:  214 EGHESAIADVSWHMKNENLFGSAGEDGRLVIWDTRTNQMQHQVKVHEREVNYLSFNPFNEWVLATASSDSTVALFDLRKLNAPL---------HVMSSHEGEVFQVEWDPNHETVLASSGEDRRLMVWDL 334          
BLAST of CD860223 vs. TAIR peptide
Match: AT1G15470.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr1:5315838-5317696 FORWARD LENGTH=333)

HSP 1 Score: 56.225 bits (134), Expect = 1.609e-8
Identity = 36/127 (28.35%), Postives = 58/127 (45.67%), Query Frame = 3
Query:  183 TLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDI 563
            T +GH G V+S        R  SAS D    +WNALT  + H+ +     V  CAFS     +  GG++ +  IF+LN P          + +    G + + +++  ++T L + +      LWDI
Sbjct:   51 TFEGHKGAVWSCSLDKNAIRAASASADFTAKIWNALTGDELHSFEHKHI-VRACAFSEDTHRLLTGGMEKILRIFDLNRPD------APPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDI 170          
BLAST of CD860223 vs. TAIR peptide
Match: AT5G23430.2 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr5:7894073-7899862 REVERSE LENGTH=836)

HSP 1 Score: 55.8398 bits (133), Expect = 2.101e-8
Identity = 39/130 (30.00%), Postives = 56/130 (43.08%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITT 569
            RTL GH     S+D+        S S D  L +W+       H  K     V    F+P G+ V  GG D++  +++L +     G L        H+G + S  + P E   L TGS D+T   WD+ T
Sbjct:   95 RTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTA-----GKLLTE--FKSHEGQIQSLDFHPHEFL-LATGSADRTVKFWDLET 216          
BLAST of CD860223 vs. TAIR peptide
Match: AT5G23430.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr5:7894073-7899862 REVERSE LENGTH=837)

HSP 1 Score: 55.8398 bits (133), Expect = 2.101e-8
Identity = 39/130 (30.00%), Postives = 56/130 (43.08%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITT 569
            RTL GH     S+D+        S S D  L +W+       H  K     V    F+P G+ V  GG D++  +++L +     G L        H+G + S  + P E   L TGS D+T   WD+ T
Sbjct:   95 RTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTA-----GKLLTE--FKSHEGQIQSLDFHPHEFL-LATGSADRTVKFWDLET 216          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G02730.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr4:1207759-1209066 FORWARD LENGTH=333)

HSP 1 Score: 55.8398 bits (133), Expect = 2.101e-8
Identity = 32/131 (24.43%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTG 572
            +TL+GHT  +  + ++++ N + SAS D  +I+W+A      H  +   + +   A+S           D    I++  SP +        ++L GH  +V    + P  +  +++GS D+T  +W++ TG
Sbjct:   37 KTLEGHTAAISCVKFSNDGNLLASASVDKTMILWSATNYSLIHRYEGHSSGISDLAWSSDSHYTCSASDDCTLRIWDARSPYE------CLKVLRGHTNFVFCVNFNPPSNL-IVSGSFDETIRIWEVKTG 160          
BLAST of CD860223 vs. TAIR peptide
Match: AT5G25150.1 (| Symbols: TAF5 | TBP-associated factor 5 | chr5:8677117-8682058 FORWARD LENGTH=669)

HSP 1 Score: 55.4546 bits (132), Expect = 2.744e-8
Identity = 40/149 (26.85%), Postives = 67/149 (44.97%), Query Frame = 3
Query:  150 TFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGG 596
            + GP        L GH+G VYS  ++   + ++S+S D  + +W+   +      K     V    FSP G   A    D    I++++        +   R+++GH   V   Q+ P  + ++ TGS D+T  LWD+ TG    +F G
Sbjct:  402 SIGPNGRRSYTLLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDAQFSPFGHYFASCSHDRTARIWSMD-------RIQPLRIMAGHLSDVDCVQWHPNCN-YIATGSSDKTVRLWDVQTGECVRIFIG 542          

HSP 2 Score: 54.299 bits (129), Expect = 6.114e-8
Identity = 37/133 (27.82%), Postives = 59/133 (44.36%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLR 578
            R + GH   V  + W    N I + S D  + +W+  T +         + V++ A SP G+ +A G  D    +++L++             L GH   V S  Y  GE + L +GS D T  LWD+T+  +
Sbjct:  496 RIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQTGECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTA-------RCITPLMGHNSCVWSLSY-SGEGSLLASGSADCTVKLWDVTSSTK 620          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G34460.4 (| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protein beta 1 | chr4:16477393-16479266 REVERSE LENGTH=372)

HSP 1 Score: 300.056 bits (767), Expect = 3.974e-90
Identity = 137/164 (83.54%), Postives = 151/164 (92.07%), Query Frame = 3
Query:  129 SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            +QGR  V+FG TD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:   37 AQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 200          

HSP 2 Score: 49.6766 bits (117), Expect = 3.974e-90
Identity = 23/29 (79.31%), Postives = 27/29 (93.10%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV+ELKERH  ATETVNNLR++L+QRRL
Sbjct:    1 MSVSELKERHAVATETVNNLRDQLRQRRL 29          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G34460.1 (| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protein beta 1 | chr4:16477393-16479266 REVERSE LENGTH=377)

HSP 1 Score: 302.368 bits (773), Expect = 1.289e-82
Identity = 141/180 (78.33%), Postives = 157/180 (87.22%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR ++      A Y  +QGR  V+FG TD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:   26 QRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 205          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G34460.3 (| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protein beta 1 | chr4:16477586-16479266 REVERSE LENGTH=347)

HSP 1 Score: 302.368 bits (773), Expect = 1.289e-82
Identity = 141/180 (78.33%), Postives = 157/180 (87.22%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR ++      A Y  +QGR  V+FG TD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:   26 QRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 205          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G34460.2 (| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protein beta 1 | chr4:16477393-16478769 REVERSE LENGTH=315)

HSP 1 Score: 257.299 bits (656), Expect = 4.755e-69
Identity = 118/139 (84.89%), Postives = 129/139 (92.81%), Query Frame = 3
Query:  204 KVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            +VYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:    5 QVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 143          
BLAST of CD860223 vs. TAIR peptide
Match: AT2G16780.1 (| Symbols: MSI2, MSI02, NFC02, NFC2 | Transducin family protein / WD-40 repeat family protein | chr2:7281615-7283583 REVERSE LENGTH=415)

HSP 1 Score: 60.4622 bits (145), Expect = 8.531e-10
Identity = 36/130 (27.69%), Postives = 65/130 (50.00%), Query Frame = 3
Query:  189 QGHTGKVYSLDW-TSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV-ACGGLDSVCSIFN---LNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDI 563
            +GH   +  + W    +N   SA +DGRL++W+  T+Q  H +K+    V   +F+P  + V A    DS  ++F+   LN+P           ++S H+G V   ++ P  +T L +   D+  ++WD+
Sbjct:  214 EGHESAIADVSWHMKNENLFGSAGEDGRLVIWDTRTNQMQHQVKVHEREVNYLSFNPFNEWVLATASSDSTVALFDLRKLNAPL---------HVMSSHEGEVFQVEWDPNHETVLASSGEDRRLMVWDL 334          
BLAST of CD860223 vs. TAIR peptide
Match: AT1G15470.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr1:5315838-5317696 FORWARD LENGTH=333)

HSP 1 Score: 56.225 bits (134), Expect = 1.609e-8
Identity = 36/127 (28.35%), Postives = 58/127 (45.67%), Query Frame = 3
Query:  183 TLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDI 563
            T +GH G V+S        R  SAS D    +WNALT  + H+ +     V  CAFS     +  GG++ +  IF+LN P          + +    G + + +++  ++T L + +      LWDI
Sbjct:   51 TFEGHKGAVWSCSLDKNAIRAASASADFTAKIWNALTGDELHSFEHKHI-VRACAFSEDTHRLLTGGMEKILRIFDLNRPD------APPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDI 170          
BLAST of CD860223 vs. TAIR peptide
Match: AT5G23430.2 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr5:7894073-7899862 REVERSE LENGTH=836)

HSP 1 Score: 55.8398 bits (133), Expect = 2.101e-8
Identity = 39/130 (30.00%), Postives = 56/130 (43.08%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITT 569
            RTL GH     S+D+        S S D  L +W+       H  K     V    F+P G+ V  GG D++  +++L +     G L        H+G + S  + P E   L TGS D+T   WD+ T
Sbjct:   95 RTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTA-----GKLLTE--FKSHEGQIQSLDFHPHEFL-LATGSADRTVKFWDLET 216          
BLAST of CD860223 vs. TAIR peptide
Match: AT5G23430.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr5:7894073-7899862 REVERSE LENGTH=837)

HSP 1 Score: 55.8398 bits (133), Expect = 2.101e-8
Identity = 39/130 (30.00%), Postives = 56/130 (43.08%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITT 569
            RTL GH     S+D+        S S D  L +W+       H  K     V    F+P G+ V  GG D++  +++L +     G L        H+G + S  + P E   L TGS D+T   WD+ T
Sbjct:   95 RTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTA-----GKLLTE--FKSHEGQIQSLDFHPHEFL-LATGSADRTVKFWDLET 216          
BLAST of CD860223 vs. TAIR peptide
Match: AT4G02730.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr4:1207759-1209066 FORWARD LENGTH=333)

HSP 1 Score: 55.8398 bits (133), Expect = 2.101e-8
Identity = 32/131 (24.43%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTG 572
            +TL+GHT  +  + ++++ N + SAS D  +I+W+A      H  +   + +   A+S           D    I++  SP +        ++L GH  +V    + P  +  +++GS D+T  +W++ TG
Sbjct:   37 KTLEGHTAAISCVKFSNDGNLLASASVDKTMILWSATNYSLIHRYEGHSSGISDLAWSSDSHYTCSASDDCTLRIWDARSPYE------CLKVLRGHTNFVFCVNFNPPSNL-IVSGSFDETIRIWEVKTG 160          
BLAST of CD860223 vs. TAIR peptide
Match: AT5G25150.1 (| Symbols: TAF5 | TBP-associated factor 5 | chr5:8677117-8682058 FORWARD LENGTH=669)

HSP 1 Score: 55.4546 bits (132), Expect = 2.744e-8
Identity = 40/149 (26.85%), Postives = 67/149 (44.97%), Query Frame = 3
Query:  150 TFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGG 596
            + GP        L GH+G VYS  ++   + ++S+S D  + +W+   +      K     V    FSP G   A    D    I++++        +   R+++GH   V   Q+ P  + ++ TGS D+T  LWD+ TG    +F G
Sbjct:  402 SIGPNGRRSYTLLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDAQFSPFGHYFASCSHDRTARIWSMD-------RIQPLRIMAGHLSDVDCVQWHPNCN-YIATGSSDKTVRLWDVQTGECVRIFIG 542          

HSP 2 Score: 54.299 bits (129), Expect = 6.114e-8
Identity = 37/133 (27.82%), Postives = 59/133 (44.36%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLR 578
            R + GH   V  + W    N I + S D  + +W+  T +         + V++ A SP G+ +A G  D    +++L++             L GH   V S  Y  GE + L +GS D T  LWD+T+  +
Sbjct:  496 RIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQTGECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTA-------RCITPLMGHNSCVWSLSY-SGEGSLLASGSADCTVKLWDVTSSTK 620          
BLAST of CD860223 vs. TrEMBL
Match: Q9XFK0_PEA (G protein beta subunit OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 7.801e-101
Identity = 163/167 (97.60%), Postives = 163/167 (97.60%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSP DRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVF GEFQSGHTA
Sbjct:   39 YARSQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPLDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFLGEFQSGHTA 205          

HSP 2 Score: 51.2174 bits (121), Expect = 7.801e-101
Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSVA++KERHIAATETVNNLRERL + RLS
Sbjct:    1 MSVADVKERHIAATETVNNLRERLSRDRLS 30          
BLAST of CD860223 vs. TrEMBL
Match: C6THC3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 3.847e-100
Identity = 158/167 (94.61%), Postives = 162/167 (97.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGR+PVTFGPTD++CCRTLQGH GKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCS+FNLNSPTDRDGNL VSRMLSGHKGYVSSCQYVP EDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGRSPVTFGPTDLVCCRTLQGHAGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSLFNLNSPTDRDGNLAVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 54.299 bits (129), Expect = 3.847e-100
Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSV ELKERH+AATETVN+LRERLK+RRLS
Sbjct:    1 MSVTELKERHLAATETVNSLRERLKERRLS 30          
BLAST of CD860223 vs. TrEMBL
Match: D7TQ08_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_63.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00031958001 PE=4 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.336e-97
Identity = 152/167 (91.02%), Postives = 162/167 (97.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  +QG++PVTFGPTD++CCRTLQGHTGKVYSLDWT+EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSPTD+DGNL +S+MLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARAQGKSPVTFGPTDLVCCRTLQGHTGKVYSLDWTTEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPTDKDGNLAMSKMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 53.9138 bits (128), Expect = 1.336e-97
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSVAELKERH+AATETVN+LRERLKQ+RL
Sbjct:    1 MSVAELKERHMAATETVNSLRERLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: B9H0Q0_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_712950 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 8.597e-97
Identity = 152/167 (91.02%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  +Q R+PV+FGPTD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTD+DGNL VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTG+RTSVFGGEFQSGHTA
Sbjct:   39 YARAQERSPVSFGPTDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGIRTSVFGGEFQSGHTA 205          

HSP 2 Score: 53.5286 bits (127), Expect = 8.597e-97
Identity = 25/29 (86.21%), Postives = 29/29 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV+ELKERH+AATETVN+LRERLKQ+RL
Sbjct:    1 MSVSELKERHVAATETVNSLRERLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: B9RBE4_RICCO (Guanine nucleotide-binding protein beta, putative OS=Ricinus communis GN=RCOM_1674940 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.909e-96
Identity = 151/167 (90.42%), Postives = 161/167 (96.41%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  +QG+ PV+FGPTD++CCRTLQGHTGKVYSLDWT+EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPT++DGNL VS+MLSGHKGYVS+CQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARAQGKTPVSFGPTDLVCCRTLQGHTGKVYSLDWTAEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTEKDGNLPVSKMLSGHKGYVSACQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 51.9878 bits (123), Expect = 1.909e-96
Identity = 25/29 (86.21%), Postives = 27/29 (93.10%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSVAELK RH+AATETVN LRERLKQ+RL
Sbjct:    1 MSVAELKARHVAATETVNTLRERLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: B9HRN9_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_722050 PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 7.214e-96
Identity = 152/164 (92.68%), Postives = 157/164 (95.73%), Query Frame = 3
Query:  129 SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            +QGR PV+FGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIFNLNSPTD+DGNL VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   42 AQGRNPVSFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPAGQSVACGGLDSVCSIFNLNSPTDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 50.8322 bits (120), Expect = 7.214e-96
Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV+ELKERH+AATETVN+L ERLKQ+RL
Sbjct:    1 MSVSELKERHVAATETVNSLGERLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: Q9FV61_TOBAC (Heterotrimeric GTP-binding protein subunit beta 1 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 6.053e-95
Identity = 152/167 (91.02%), Postives = 157/167 (94.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 50.0618 bits (118), Expect = 6.053e-95
Identity = 23/29 (79.31%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVTELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: Q9SW94_PEA (G protein beta subunit OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 2.014e-94
Identity = 168/180 (93.33%), Postives = 169/180 (93.89%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR +       A Y  SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   26 QRRLSLLDTDIAGYARSQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 59.6918 bits (143), Expect = 2.441e-7
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSVAELKERHIAATETVNNLRERLKQRRLS
Sbjct:    1 MSVAELKERHIAATETVNNLRERLKQRRLS 30          
BLAST of CD860223 vs. TrEMBL
Match: C5MTW2_NICBE (Heterotrimeric G protein beta 2 subunit OS=Nicotiana benthamiana PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 6.626e-94
Identity = 152/167 (91.02%), Postives = 157/167 (94.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 46.595 bits (109), Expect = 6.626e-94
Identity = 22/29 (75.86%), Postives = 27/29 (93.10%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+L E+LKQ+RL
Sbjct:    1 MSVKELKERHMAATQTVNDLCEKLKQKRL 29          
BLAST of CD860223 vs. TrEMBL
Match: Q8LJQ7_PEA (G protein beta subunit OS=Pisum sativum PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 9.998e-94
Identity = 167/180 (92.78%), Postives = 168/180 (93.33%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR +       A Y  SQGRAPVT GPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   26 QRRLSLLDTDIAGYARSQGRAPVTLGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          
BLAST of CD860223 vs. Lotus protein
Match: chr1.CM0113.1970.r2.d (- phase: 0 )

HSP 1 Score: 340.887 bits (873), Expect = 1.602e-103
Identity = 162/167 (97.01%), Postives = 163/167 (97.60%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGRAPVTFGPTDILCCRTLQGHTGKVY+LDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNS TDRDGNLNVSRMLSGHKGYVSSCQYVP EDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YAKSQGRAPVTFGPTDILCCRTLQGHTGKVYALDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSSTDRDGNLNVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 52.7582 bits (125), Expect = 1.602e-103
Identity = 25/30 (83.33%), Postives = 27/30 (90.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSV ELKERH+ A ETVNNLRERLKQ+RLS
Sbjct:    1 MSVTELKERHLTAAETVNNLRERLKQKRLS 30          
BLAST of CD860223 vs. Lotus protein
Match: chr5.CM0278.190.r2.m (- phase: 0 /partial)

HSP 1 Score: 56.6102 bits (135), Expect = 7.243e-9
Identity = 33/123 (26.83%), Postives = 55/123 (44.72%), Query Frame = 3
Query:  189 QGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLW 557
            +GH+  VY L +  + +   S   D    VW+  T +   A++     ++  +FSP G  +A GG D+ C I++L               +  H   +S  ++ P E   L+TGS D T  +W
Sbjct:  398 EGHSRSVYGLAFHHDGSLAASCGLDSLARVWDLRTGRSILALEGHVKPILGISFSPNGYHLATGGEDNTCRIWDLRKKKS-------LYTIPAHSNLISQVKFEPQEGYFLVTGSYDMTAKVW 513          
BLAST of CD860223 vs. Lotus protein
Match: chr4.CM0042.2040.r2.a (+ phase: 0 )

HSP 1 Score: 55.0694 bits (131), Expect = 2.107e-8
Identity = 41/138 (29.71%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA---WVMTCAFSPT--GQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLR 578
            R   GHT  V S+ ++ +  +IVSAS+D  + +WN L   K + I+   A   WV    FSP+    ++     D    ++NL        N  +   L+GH GYV++    P + +   +G  D   +LWD+  G R
Sbjct:   99 RRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKLWNTLGECK-YTIQDNDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLT-------NCKLRNTLAGHSGYVNTVAVSP-DGSLCASGGKDGVILLWDLAEGKR 227          
BLAST of CD860223 vs. Lotus protein
Match: LjSGA_045237.1 (+ phase: 0 /partial)

HSP 1 Score: 52.7582 bits (125), Expect = 1.046e-7
Identity = 42/150 (28.00%), Postives = 63/150 (42.00%), Query Frame = 3
Query:  183 TLQGHTGKVYSLDWTSEK--NRIVSASQDGRLIVW---NALTSQKTHAIKLPCAWVMTCAFSP--TGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSG-------------DQTCVLWDITTG 572
            TL GH G V+ + W   K  + I S S DGR+I+W   N     + H      + V +  ++P   G  +ACG  D   S+F   +    DG  + SR+   H   V+S  + P      + G+G             D T  +W +T G
Sbjct:   63 TLAGHQGPVWQVAWAHPKFGSMIASCSYDGRVIIWKEGNQNEWIQAHVFDDHKSSVNSVVWAPHELGLCLACGSSDGNISVFTARA----DGGWDTSRIDQAHPVGVTSVSWAPSMAPGALVGAGLLDPVQKLCSGGCDNTVKVWKLTNG 208          
BLAST of CD860223 vs. Lotus protein
Match: chr2.LjT15I01.10.r2.d (+ phase: 0 )

HSP 1 Score: 52.7582 bits (125), Expect = 1.046e-7
Identity = 38/133 (28.57%), Postives = 56/133 (42.11%), Query Frame = 3
Query:  174 CCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTG 572
            C  TL  HT  V +L +T   N ++SAS DG +  W+ L  +       P +       +     V C G      IF  +  T R     +  +LSGH+  V    + P  +  L + S D+T  LWD+  G
Sbjct:  408 CFVTLTEHTNAVTALHFTGTNNCLLSASLDGTVRAWDLLRYRNFRIFTTPSSRQFVSLAADQSGEVVCAGTSDSFEIFVWSMRTGR-----LLDVLSGHEAPVHGLMFSP-TNAVLASSSWDKTVRLWDVFDG 534          
BLAST of CD860223 vs. Lotus protein
Match: chr2.CM0373.1120.r2.m (+ phase: 0 /partial)

HSP 1 Score: 51.9878 bits (123), Expect = 1.784e-7
Identity = 36/130 (27.69%), Postives = 53/130 (40.77%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITT 569
            RTL GH     S+D+        S S D  L +W+       H  K     V    F+P G+ V  GG D+   +++L +         +      H+G +    + P E   L TGS D+T   WD+ T
Sbjct:   95 RTLTGHRSNCTSVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG-------KLLHDFKSHEGQIQCIDFHPNEFL-LATGSADRTVKFWDLET 216          
BLAST of CD860223 vs. Lotus protein
Match: chr6.LjT35H04.230.r2.d (+ phase: 0 /partial)

HSP 1 Score: 51.2174 bits (121), Expect = 3.043e-7
Identity = 37/130 (28.46%), Postives = 57/130 (43.85%), Query Frame = 3
Query:  183 TLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTG 572
            TL GH  +V  L  ++    + SA  D ++  W+   ++   +     + V   A  PT   +  GG DSVC ++++ S             LSGH   V S    P  D  ++TGS D T  +WD+  G
Sbjct:  158 TLTGHIEQVRGLAISNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCLALHPTIDVLLTGGRDSVCRVWDIRSKMQ-------VHALSGHDNTVCSVFTRP-TDPQVVTGSHDSTIKMWDLRYG 279          
BLAST of CD860223 vs. Lotus protein
Match: chr6.CM1650.60.r2.m (+ phase: 0 )

HSP 1 Score: 50.447 bits (119), Expect = 5.190e-7
Identity = 33/126 (26.19%), Postives = 54/126 (42.86%), Query Frame = 3
Query:  195 HTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAI-KLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITT 569
            H   V  +D++ +   + S SQDG++ VW   T Q    + +     V + +FS  G  +     DS   I  L S         + +   GH  YV+   +   + + +IT S D T  +WD+ T
Sbjct:  263 HDDAVLCVDFSRDSEMLASGSQDGKIKVWRIRTGQCLRRLERAHSQGVTSLSFSRDGSQLLSTSFDSTARIHGLKSG-------KMLKEFRGHTSYVNDATFT-NDGSRVITASSDCTVKVWDVKT 380          
BLAST of CD860223 vs. Lotus protein
Match: chr5.CM0328.50.r2.d (- phase: 0 /partial)

HSP 1 Score: 50.447 bits (119), Expect = 5.190e-7
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query:  189 QGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIF 407
            +GH G VY + W+++   I+S S+D  L VW+  T +    +      V +  +SP G+ VA GG D V  ++
Sbjct:   39 RGHVGPVYQISWSADSRLILSGSKDSTLKVWDIRTRKLRQDLPGHADEVFSVDWSPDGEKVASGGKDKVLKLW 111          
BLAST of CD860223 vs. Lotus protein
Match: chr4.LjT33M20.50.r2.d (+ phase: 0 )

HSP 1 Score: 50.0618 bits (118), Expect = 6.779e-7
Identity = 35/130 (26.92%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  183 TLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTG 572
            T +GH G V+S    +   R  SAS D    VW+ALT  + H+ +        CAFS     +  GG++ +  I+++N P      ++ S       G V +  ++  + T L + +      LWD+ +G
Sbjct:   56 TFEGHKGAVWSCCLDTNALRAASASADFSTKVWDALTGDELHSFEHKHI-ARACAFSEDTHLLLTGGVEKILRIYDMNRPDAPPREVDKS------PGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSG 178          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma04g01460.1|PACid:16254469 ()

HSP 1 Score: 336.265 bits (861), Expect = 3.452e-102
Identity = 158/167 (94.61%), Postives = 162/167 (97.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGR+PVTFGPTD++CCRTLQGH GKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCS+FNLNSPTDRDGNL VSRMLSGHKGYVSSCQYVP EDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGRSPVTFGPTDLVCCRTLQGHAGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSLFNLNSPTDRDGNLAVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 54.299 bits (129), Expect = 3.452e-102
Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSV ELKERH+AATETVN+LRERLK+RRLS
Sbjct:    1 MSVTELKERHLAATETVNSLRERLKERRLS 30          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma06g01510.1|PACid:16261347 ()

HSP 1 Score: 332.798 bits (852), Expect = 4.931e-101
Identity = 156/167 (93.41%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGRAPVTFGPTD++CCR LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSP DRDGNL VS+MLSGHKGYVSSCQYVP EDTHL+TGSGDQTCVLWDITTG RTSVFGGEFQSGHTA
Sbjct:   39 YARSQGRAPVTFGPTDLVCCRALQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPADRDGNLAVSQMLSGHKGYVSSCQYVPDEDTHLVTGSGDQTCVLWDITTGFRTSVFGGEFQSGHTA 205          

HSP 2 Score: 53.9138 bits (128), Expect = 4.931e-101
Identity = 25/30 (83.33%), Postives = 29/30 (96.67%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSV ELKERH+AATET+N+LRERLK+RRLS
Sbjct:    1 MSVTELKERHLAATETINSLRERLKERRLS 30          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma11g12600.1|PACid:16283648 ()

HSP 1 Score: 328.561 bits (841), Expect = 4.531e-99
Identity = 154/167 (92.22%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGR PVTFGPTD++CCRTLQGHTGKVYSLDWTSEK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTD+DGNL VSRMLSGHKGYVSSCQYVP EDTHLITGSGDQTCVLWDITTGL+TSVFGGEFQSGHTA
Sbjct:   39 YARSQGRTPVTFGPTDLVCCRTLQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQTCVLWDITTGLKTSVFGGEFQSGHTA 205          

HSP 2 Score: 51.6026 bits (122), Expect = 4.531e-99
Identity = 25/30 (83.33%), Postives = 27/30 (90.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSV ELKERH AAT+TVNNLR RLKQ+RLS
Sbjct:    1 MSVTELKERHSAATDTVNNLRHRLKQKRLS 30          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma12g04810.1|PACid:16286418 ()

HSP 1 Score: 328.176 bits (840), Expect = 5.912e-99
Identity = 153/167 (91.62%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGR PVTFGPTD++CCRTLQGHTGKVYSLDWTSEK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTD+DGNL VSRMLSGHKGYVSSCQYVP EDTHLITGSGDQTCVLWDITTGL+TS+FGGEFQSGHTA
Sbjct:   39 YARSQGRTPVTFGPTDLVCCRTLQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQTCVLWDITTGLKTSIFGGEFQSGHTA 205          

HSP 2 Score: 51.6026 bits (122), Expect = 5.912e-99
Identity = 25/30 (83.33%), Postives = 27/30 (90.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSV ELKERH AAT+TVNNLR RLKQ+RLS
Sbjct:    1 MSVTELKERHSAATDTVNNLRHRLKQKRLS 30          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma02g34620.1|PACid:16249058 ()

HSP 1 Score: 56.6102 bits (135), Expect = 1.858e-8
Identity = 33/123 (26.83%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  189 QGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLW 557
            +GH+  VY L + ++ +   S   D    VW+  T +   A++     V++ +FSP G  +A GG D+ C I++L               +  H   +S  ++ P E   L+T S D T  +W
Sbjct:  400 EGHSRSVYGLAFHNDGSLAASCGLDSLARVWDLRTGRSILALEGHVKPVLSISFSPNGYHLATGGEDNTCRIWDLRKKKS-------FYTIPAHSNLISQVKFEPHEGYFLVTASYDMTAKVW 515          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma10g00300.1|PACid:16278085 ()

HSP 1 Score: 55.4546 bits (132), Expect = 4.139e-8
Identity = 33/123 (26.83%), Postives = 55/123 (44.72%), Query Frame = 3
Query:  189 QGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLW 557
            +GH+  VY L + ++ +   S   D    VW+  T +   A++     V+  +FSP G  +A GG D+ C I++L               +  H   +S  ++ P E   L+T S D T  +W
Sbjct:  400 EGHSRSVYGLAFHNDGSLAASCGLDSLARVWDLRTGRSILALEGHVKPVLGISFSPNGYHLATGGEDNTCRIWDLRKKKS-------FYTIPAHSNLISQVKFEPQEGYFLVTASYDMTAKVW 515          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma08g05610.1|PACid:16270092 ()

HSP 1 Score: 55.0694 bits (131), Expect = 5.405e-8
Identity = 41/138 (29.71%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA---WVMTCAFSPT--GQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLR 578
            R   GHT  V S+ ++ +  +IVSAS+D  + +WN L   K + I+   A   WV    FSP+    ++     D    ++NL        N  +   L+GH GYV++    P + +   +G  D   +LWD+  G R
Sbjct:   99 RRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKLWNTLGECK-YTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLT-------NCKLRNTLAGHNGYVNTVAVSP-DGSLCASGGKDGVILLWDLAEGKR 227          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma05g34070.1|PACid:16260620 ()

HSP 1 Score: 55.0694 bits (131), Expect = 5.405e-8
Identity = 41/138 (29.71%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA---WVMTCAFSPT--GQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLR 578
            R   GHT  V S+ ++ +  +IVSAS+D  + +WN L   K + I+   A   WV    FSP+    ++     D    ++NL        N  +   L+GH GYV++    P + +   +G  D   +LWD+  G R
Sbjct:   99 RRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKLWNTLGECK-YTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLT-------NCKLRNTLAGHNGYVNTVAVSP-DGSLCASGGKDGVILLWDLAEGKR 227          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma02g16570.1|PACid:16248297 ()

HSP 1 Score: 54.299 bits (129), Expect = 9.220e-8
Identity = 34/142 (23.94%), Postives = 60/142 (42.25%), Query Frame = 3
Query:  147 VTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTG 572
            + +    +  C  L GH+  +  L W+S+ + I SAS D  L +W+A        ++     V    F+P    +  G  D    ++++ +             + GH   V+S  Y   + T +I+ S D +C +WD  TG
Sbjct:   56 IIWSSATLTLCHRLVGHSEGISDLAWSSDSHYICSASDDHTLRIWDATGGDCVKILRGHDDVVFCVNFNPQSSYIVSGSFDETIKVWDVKTG-------KCVHTIKGHTMPVTSVHY-NRDGTLIISASHDGSCKIWDTRTG 189          
BLAST of CD860223 vs. Soybean peptides
Match: Glyma15g07510.1|PACid:16297965 ()

HSP 1 Score: 53.9138 bits (128), Expect = 1.204e-7
Identity = 35/130 (26.92%), Postives = 57/130 (43.85%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITT 569
            RT+ GH     ++++        S S D  L +W+       H  K     + T  F+P G+ V  GG D+V  +++L +         +      H+G++ S  + P E   L TGS D+T   WD+ T
Sbjct:   94 RTVAGHRSNCTAVEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHSQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG-------KLLHDFKFHEGHIRSIDFHPLEFL-LATGSADRTVKFWDLET 215          
BLAST of CD860223 vs. SwissProt
Match: GBB1_TOBAC (Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 3.538e-96
Identity = 152/167 (91.02%), Postives = 157/167 (94.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 50.0618 bits (118), Expect = 3.538e-96
Identity = 23/29 (79.31%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVTELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB3_TOBAC (Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.969e-95
Identity = 151/167 (90.42%), Postives = 157/167 (94.01%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSI+NLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIYNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 48.1358 bits (113), Expect = 2.969e-95
Identity = 22/29 (75.86%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TV++LRE+LKQ+RL
Sbjct:    1 MSVTELKERHMAATQTVSDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB2_TOBAC (Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 5.053e-95
Identity = 150/167 (89.82%), Postives = 156/167 (93.41%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PV FGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTH+IT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YARSQGKTPVIFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHVITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 49.6766 bits (117), Expect = 5.053e-95
Identity = 23/29 (79.31%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVKELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_NICPL (Guanine nucleotide-binding protein subunit beta OS=Nicotiana plumbaginifolia PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 6.592e-95
Identity = 150/167 (89.82%), Postives = 155/167 (92.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQG+ PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+G SVACGGLDSVCSIFNLNSP D+DGN  VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQ GHTA
Sbjct:   39 YARSQGKTPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGHSVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQFGHTA 205          

HSP 2 Score: 50.0618 bits (118), Expect = 6.592e-95
Identity = 23/29 (79.31%), Postives = 28/29 (96.55%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSV ELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVTELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_SOLTU (Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.122e-94
Identity = 149/167 (89.22%), Postives = 155/167 (92.81%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y   QG++PVTFGPTD++CCR LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQSVACGGLDS CSIFNLNSP D+DG   VSRMLSGHKGYVSSCQYVP EDTHLIT SGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   39 YAKRQGKSPVTFGPTDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQSVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 51.6026 bits (122), Expect = 1.122e-94
Identity = 24/29 (82.76%), Postives = 29/29 (100.00%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRL 108
            MSVAELKERH+AAT+TVN+LRE+LKQ+RL
Sbjct:    1 MSVAELKERHMAATQTVNDLREKLKQKRL 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_ORYSJ (Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. japonica GN=Os03g0669200 PE=1 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.929e-85
Identity = 135/167 (80.84%), Postives = 148/167 (88.62%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  +QGR PV+F PTD++CCRTLQGH+GKVYSLDWT EKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQSVACGGLDS CSIFNLNS  DRDGN+ VSR+L+GHKGYVSSCQYVP ++T LIT SGDQTCVLWD+TTG R S+FGGEF SGHTA
Sbjct:   40 YSRTQGRTPVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQSVACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTCVLWDVTTGQRISIFGGEFPSGHTA 206          

HSP 2 Score: 44.669 bits (104), Expect = 1.929e-85
Identity = 21/27 (77.78%), Postives = 25/27 (92.59%), Query Frame = 1
Query:   25 SVAELKERHIAATETVNNLRERLKQRR 105
            SVAELKE+H AAT +VN+LRERL+QRR
Sbjct:    3 SVAELKEKHAAATASVNSLRERLRQRR 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_MAIZE (Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 3.282e-85
Identity = 135/167 (80.84%), Postives = 147/167 (88.02%), Query Frame = 3
Query:  120 YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            Y  SQGR PV+F PTD++CCRTLQGH+GKVYSLDWT EKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQSVACGGLDS CSIFNLNS  DRDGN+ VSR+L+GHKGYVSSCQYVP ++T LIT SGDQTCVLWD+TTG R S+FGGEF SGHTA
Sbjct:   40 YSKSQGRVPVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMACAFAPNGQSVACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTCVLWDVTTGQRISIFGGEFPSGHTA 206          

HSP 2 Score: 44.669 bits (104), Expect = 3.282e-85
Identity = 21/27 (77.78%), Postives = 25/27 (92.59%), Query Frame = 1
Query:   25 SVAELKERHIAATETVNNLRERLKQRR 105
            SVAELKE+H AAT +VN+LRERL+QRR
Sbjct:    3 SVAELKEKHAAATASVNSLRERLRQRR 29          
BLAST of CD860223 vs. SwissProt
Match: GBB_ARATH (Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.266e-81
Identity = 141/180 (78.33%), Postives = 157/180 (87.22%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR ++      A Y  +QGR  V+FG TD++CCRTLQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGGLDSVCSIF+L+S  D+DG + VSRML+GH+GYVS CQYVP ED HLIT SGDQTC+LWD+TTGL+TSVFGGEFQSGHTA
Sbjct:   26 QRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTA 205          
BLAST of CD860223 vs. SwissProt
Match: GBB1_DANRE (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.865e-41
Identity = 73/139 (52.52%), Postives = 105/139 (75.54%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGG 596
            RTL+GH  K+Y++ W ++   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI+NL +   R+GN+ VSR L+GH GY+S C+++  +D  ++T SGD TC LWDI TG +T+ F G
Sbjct:   49 RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGDTTCALWDIETGQQTTTFAG 182          
BLAST of CD860223 vs. SwissProt
Match: GBB1_RAT (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4)

HSP 1 Score: 166.777 bits (421), Expect = 8.299e-41
Identity = 73/139 (52.52%), Postives = 105/139 (75.54%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGG 596
            RTL+GH  K+Y++ W ++   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI+NL +   R+GN+ VSR L+GH GY+S C+++  +D  ++T SGD TC LWDI TG +T+ F G
Sbjct:   49 RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGDTTCALWDIETGQQTTTFTG 182          
BLAST of CD860223 vs. Medicago proteins
Match: IMGA|Medtr3g116500.1 (Guanine nucleotide-binding protein subunit beta-1 (AHRD V1 **** P93397); contains Interpro domain(s) IPR016346 Guanine nucleotide-binding protein, beta subunit chr03_pseudomolecule_IMGAG_V3.5 42056477-42051574 E EGN_Mt100125 20100825)

HSP 1 Score: 347.436 bits (890), Expect = 3.030e-96
Identity = 167/180 (92.78%), Postives = 168/180 (93.33%), Query Frame = 3
Query:   81 QRTIEAETAFFA*YR*SQGRAPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            QR +       A Y  SQGR PVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA
Sbjct:   26 QRRLSLLDTDIAGYAKSQGRTPVTFGPTDILCCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 205          

HSP 2 Score: 58.151 bits (139), Expect = 3.672e-9
Identity = 29/30 (96.67%), Postives = 29/30 (96.67%), Query Frame = 1
Query:   22 MSVAELKERHIAATETVNNLRERLKQRRLS 111
            MSV ELKERHIAATETVNNLRERLKQRRLS
Sbjct:    1 MSVTELKERHIAATETVNNLRERLKQRRLS 30          
BLAST of CD860223 vs. Medicago proteins
Match: IMGA|AC148471_14.1 (WD-40 repeat protein (AHRD V1 *-*- B5W1Y6_SPIMA); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region AC148471.15 33746-31612 H EGN_Mt100125 20100825)

HSP 1 Score: 61.6178 bits (148), Expect = 3.321e-10
Identity = 42/142 (29.58%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  183 TLQGHTGKV--YSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGGEF 602
            TL+GH   V   ++  T +  R VSAS DG L VW+  +      ++   AWV   A +P G     G  D    +++L +         +  +L+GH   VS+ +  P + T  ++ S D T  +WD+T GL+ + F  E+
Sbjct:  182 TLEGHVATVSAVAVAATPDGARAVSASFDGTLRVWDLRSGGLLRVLEGHTAWVTAVAVTPNGACAVSGLEDGNLRVWDLETG-------RLKGVLAGHAARVSAVELTP-DGTRAVSASYDGTVRVWDLTLGLQLASFATEY 315          

HSP 2 Score: 55.0694 bits (131), Expect = 3.109e-8
Identity = 43/148 (29.05%), Postives = 61/148 (41.22%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGED-THLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTA 620
            RTL GHT ++ ++  T +  R VS S DG L VW+  +      ++   AWV   A +P G        D    I+ L S         +   L GH   VS+       D    ++ S D T  +WD+ +G    V       GHTA
Sbjct:   97 RTLVGHTDRILAVAATPDGARAVSTSFDGTLRVWDLRSGGLLRVLEGHTAWVTAVAVTPNGACAVSASEDRTLKIWKLASGC-------LEGTLEGHVATVSAVAVAATPDGARAVSASFDGTLRVWDLRSGGLLRVL-----EGHTA 232          

HSP 3 Score: 53.1434 bits (126), Expect = 1.181e-7
Identity = 37/131 (28.24%), Postives = 59/131 (45.04%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTG 572
            RTL GH G V ++  T +  R VSAS DG L VW   + +    +      ++  A +P G        D    +++L     R G L   R+L GH  +V++    P      ++ S D+T  +W + +G
Sbjct:   55 RTLVGHAGAVTAVAATPDGARAVSASFDGTLKVWELASGRLERTLVGHTDRILAVAATPDGARAVSTSFDGTLRVWDL-----RSGGL--LRVLEGHTAWVTAVAVTP-NGACAVSASEDRTLKIWKLASG 177          
BLAST of CD860223 vs. Medicago proteins
Match: IMGA|Medtr1g072140.1 (WD repeat-containing protein 5 (AHRD V1 ***- Q498M4); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region chr01_pseudomolecule_IMGAG_V3.5 17992447-17990367 E EGN_Mt100125 20100825)

HSP 1 Score: 57.3806 bits (137), Expect = 6.264e-9
Identity = 39/141 (27.66%), Postives = 62/141 (43.97%), Query Frame = 3
Query:  174 CCRTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLRTSVFGG 596
            C +TL+GH   V+ +++  + N IVS S D  + VW   T +  H IK     V +  F+  G  +  G  D  C I++ NS     G L +  ++      VS  ++ P     L+    D T  LW+   G    ++ G
Sbjct:  103 CVKTLRGHGHNVFCVNFNPQSNYIVSGSFDETVRVWEVKTGKSVHVIKAHAMPVTSVDFNRDGSLIVSGSHDGSCKIWDTNS-----GAL-LKTLIDDKVPAVSFAKFSPNGKFILVATLND-TLKLWNYAAGRSLKMYSG 236          
BLAST of CD860223 vs. Medicago proteins
Match: IMGA|Medtr5g022690.1 (U4/U6 small nuclear ribonucleoprotein PRP4-like protein (AHRD V1 ***- O22212); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region chr05_pseudomolecule_IMGAG_V3.5 8715986-8712801 E EGN_Mt100125 20100825)

HSP 1 Score: 56.6102 bits (135), Expect = 1.068e-8
Identity = 34/123 (27.64%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  189 QGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLW 557
            +GH+ +VYSL +  + +   S  +D    VW+  T +   A++     +   +FSP G  +A GG D+ C I++L     ++ +L     ++ H   +S  ++ P E   L+T S D T  +W
Sbjct:  318 EGHSREVYSLAFHHDGSLAASCGKDALARVWDLRTKRSLLALEGHVKPIRGISFSPNGYHLATGGEDNTCRIWDLR----KNKSLYT---IAAHSKLISQVKFEPQEGYFLVTTSSDMTAKVW 433          
BLAST of CD860223 vs. Medicago proteins
Match: IMGA|Medtr8g106790.1 (Guanine nucleotide-binding protein subunit beta-like protein (AHRD V1 **** O24076); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region chr08_pseudomolecule_IMGAG_V3.5 31975542-31982663 E EGN_Mt100125 20100825)

HSP 1 Score: 55.0694 bits (131), Expect = 3.109e-8
Identity = 41/138 (29.71%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA---WVMTCAFSPT--GQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTGLR 578
            R   GHT  V S+ ++ +  +IVSAS+D  + +WN L   K + I+   A   WV    FSP+    ++     D    ++NL        N  +   L+GH GYV++    P + +   +G  D   +LWD+  G R
Sbjct:   99 RRFVGHTKDVLSVAFSIDNRQIVSASRDRTIKLWNTLGECK-YTIQDGDAHSDWVSCVRFSPSTLQPTIVSASWDRTVKVWNLT-------NCKLRNTLAGHSGYVNTVAVSP-DGSLCASGGKDGVILLWDLAEGKR 227          
BLAST of CD860223 vs. Medicago proteins
Match: IMGA|Medtr2g012630.1 (Katanin p80 WD40-containing subunit B1 (AHRD V1 *-*- O61585); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region chr02_pseudomolecule_IMGAG_V3.5 3378331-3367311 E EGN_Mt100125 20100825)

HSP 1 Score: 55.0694 bits (131), Expect = 3.109e-8
Identity = 43/160 (26.88%), Postives = 67/160 (41.88%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDI------------TTGLRTSVF---GGEFQSGH 614
            RT+ GH     S+++        S S D  L +W+       H  K     + T  F+P G+ V  GG D+V  +++L +         +    + H G+++S  + P E   L TGS D+T   WD+             TG+R+  F   G    SGH
Sbjct:  114 RTVAGHRSNCTSVEFHPFGEFFASGSMDTNLKIWDNRKKGCIHTYKGHSQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG-------KLLHDFNFHDGHITSLDFHPLEFL-LATGSADRTVKFWDLESFELIGSARREATGVRSMAFHPDGRTLFSGH 265          
BLAST of CD860223 vs. Medicago proteins
Match: IMGA|AC148471_31.1 (WD-40 repeat protein (AHRD V1 *--- B5W1Y6_SPIMA); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region AC148471.15 87626-91457 H EGN_Mt100125 20100825)

HSP 1 Score: 52.373 bits (124), Expect = 2.015e-7
Identity = 39/131 (29.77%), Postives = 58/131 (44.27%), Query Frame = 3
Query:  180 RTLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITTG 572
            RTL+G+TG V ++  T +  R VS  +DG L  W   +     +++     V   A +P G     G  D    +++L     R G L  S  L GH   VS+    P      ++ S D T  +WD+T G
Sbjct:  955 RTLEGYTGGVSAVAVTPDGARAVSGLEDGTLRTWGQASGGLVQSLEGHADLVTAVAVTPDGTRAVSGSFDGTLKVWDL-----RLGVLKWS--LGGHAARVSAVAVAPC-GCRAVSASYDGTLKVWDLTEG 1077          
BLAST of CD860223 vs. Medicago proteins
Match: IMGA|Medtr3g052220.1 (WD40 repeat-containing protein SMU1 (AHRD V1 ***- Q5ZME8); contains Interpro domain(s) IPR020472 G-protein beta WD-40 repeat, region chr03_pseudomolecule_IMGAG_V3.5 16429881-16417563 E EGN_Mt100125 20100825)

HSP 1 Score: 50.447 bits (119), Expect = 7.657e-7
Identity = 35/130 (26.92%), Postives = 55/130 (42.31%), Query Frame = 3
Query:  183 TLQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIK-LPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQTCVLWDITT 569
            T   H   V  +D++ +   I S S DG++ VW   T+Q    ++      V + +FS  G  +     DS   I  L S         + +   GH  YV+   +   + T +IT S D T  +WD+ T
Sbjct:  259 TFMMHDEPVLCVDFSRDSEMIASGSTDGKIKVWRIRTAQCLRRLEHAHSQGVTSVSFSRDGSQLLSTSFDSTARIHGLKSG-------KMLKEFRGHTSYVNDATFT-NDGTRVITASSDCTVKVWDLKT 380          
The following BLAST results are available for this feature:
BLAST of CD860223 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q9XFK0_PEA6.356e-10197.60G protein beta subunit OS=Pisum sativum PE=2 SV=1[more]
C6THC3_SOYBN3.134e-10094.61Putative uncharacterized protein OS=Glycine max PE... [more]
D7TQ08_VITVI1.089e-9791.02Whole genome shotgun sequence of line PN40024, sca... [more]
B9H0Q0_POPTR7.004e-9791.02Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9RBE4_RICCO1.555e-9690.42Guanine nucleotide-binding protein beta, putative ... [more]
B9HRN9_POPTR5.878e-9692.68Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q9FV61_TOBAC4.932e-9591.02Heterotrimeric GTP-binding protein subunit beta 1 ... [more]
Q9SW94_PEA1.641e-9493.33G protein beta subunit OS=Pisum sativum PE=2 SV=1[more]
C5MTW2_NICBE5.398e-9491.02Heterotrimeric G protein beta 2 subunit OS=Nicotia... [more]
Q8LJQ7_PEA8.146e-9492.78G protein beta subunit OS=Pisum sativum PE=4 SV=1[more]
back to top
BLAST of CD860223 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
GBB1_TOBAC3.475e-9691.02Guanine nucleotide-binding protein subunit beta-1 ... [more]
GBB3_TOBAC2.916e-9590.42Guanine nucleotide-binding protein subunit beta OS... [more]
GBB2_TOBAC4.962e-9589.82Guanine nucleotide-binding protein subunit beta-2 ... [more]
GBB_NICPL6.474e-9589.82Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_SOLTU1.102e-9489.22Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_ORYSJ1.895e-8580.84Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_MAIZE3.224e-8580.84Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_ARATH1.243e-8178.33Guanine nucleotide-binding protein subunit beta OS... [more]
GBB1_DANRE4.779e-4152.52Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB1_RAT8.151e-4152.52Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
back to top
BLAST of CD860223 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT4G34460.43.974e-9083.54| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protei... [more]
AT4G34460.11.289e-8278.33| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protei... [more]
AT4G34460.31.289e-8278.33| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protei... [more]
AT4G34460.24.755e-6984.89| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protei... [more]
AT2G16780.18.531e-1027.69| Symbols: MSI2, MSI02, NFC02, NFC2 | Transducin f... [more]
AT1G15470.11.609e-828.35| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT5G23430.22.101e-830.00| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT5G23430.12.101e-830.00| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT4G02730.12.101e-824.43| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT5G25150.12.744e-826.85| Symbols: TAF5 | TBP-associated factor 5 | chr5:8... [more]
back to top
BLAST of CD860223 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT4G34460.43.974e-9083.54| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protei... [more]
AT4G34460.11.289e-8278.33| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protei... [more]
AT4G34460.31.289e-8278.33| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protei... [more]
AT4G34460.24.755e-6984.89| Symbols: AGB1, ELK4, ATAGB1 | GTP binding protei... [more]
AT2G16780.18.531e-1027.69| Symbols: MSI2, MSI02, NFC02, NFC2 | Transducin f... [more]
AT1G15470.11.609e-828.35| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT5G23430.22.101e-830.00| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT5G23430.12.101e-830.00| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT4G02730.12.101e-824.43| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT5G25150.12.744e-826.85| Symbols: TAF5 | TBP-associated factor 5 | chr5:8... [more]
back to top
BLAST of CD860223 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q9XFK0_PEA7.801e-10197.60G protein beta subunit OS=Pisum sativum PE=2 SV=1[more]
C6THC3_SOYBN3.847e-10094.61Putative uncharacterized protein OS=Glycine max PE... [more]
D7TQ08_VITVI1.336e-9791.02Whole genome shotgun sequence of line PN40024, sca... [more]
B9H0Q0_POPTR8.597e-9791.02Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9RBE4_RICCO1.909e-9690.42Guanine nucleotide-binding protein beta, putative ... [more]
B9HRN9_POPTR7.214e-9692.68Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q9FV61_TOBAC6.053e-9591.02Heterotrimeric GTP-binding protein subunit beta 1 ... [more]
Q9SW94_PEA2.014e-9493.33G protein beta subunit OS=Pisum sativum PE=2 SV=1[more]
C5MTW2_NICBE6.626e-9491.02Heterotrimeric G protein beta 2 subunit OS=Nicotia... [more]
Q8LJQ7_PEA9.998e-9492.78G protein beta subunit OS=Pisum sativum PE=4 SV=1[more]
back to top
BLAST of CD860223 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 10
Match NameE-valueIdentityDescription
chr1.CM0113.1970.r2.d1.602e-10397.01- phase: 0 [more]
chr5.CM0278.190.r2.m7.243e-926.83- phase: 0 /partial[more]
chr4.CM0042.2040.r2.a2.107e-829.71+ phase: 0 [more]
LjSGA_045237.11.046e-728.00+ phase: 0 /partial[more]
chr2.LjT15I01.10.r2.d1.046e-728.57+ phase: 0 [more]
chr2.CM0373.1120.r2.m1.784e-727.69+ phase: 0 /partial[more]
chr6.LjT35H04.230.r2.d3.043e-728.46+ phase: 0 /partial[more]
chr6.CM1650.60.r2.m5.190e-726.19+ phase: 0 [more]
chr5.CM0328.50.r2.d5.190e-732.88- phase: 0 /partial[more]
chr4.LjT33M20.50.r2.d6.779e-726.92+ phase: 0 [more]
back to top
BLAST of CD860223 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 10
Match NameE-valueIdentityDescription
Glyma04g01460.1|PACid:162544693.452e-10294.61[more]
Glyma06g01510.1|PACid:162613474.931e-10193.41[more]
Glyma11g12600.1|PACid:162836484.531e-9992.22[more]
Glyma12g04810.1|PACid:162864185.912e-9991.62[more]
Glyma02g34620.1|PACid:162490581.858e-826.83[more]
Glyma10g00300.1|PACid:162780854.139e-826.83[more]
Glyma08g05610.1|PACid:162700925.405e-829.71[more]
Glyma05g34070.1|PACid:162606205.405e-829.71[more]
Glyma02g16570.1|PACid:162482979.220e-823.94[more]
Glyma15g07510.1|PACid:162979651.204e-726.92[more]
back to top
BLAST of CD860223 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
GBB1_TOBAC3.538e-9691.02Guanine nucleotide-binding protein subunit beta-1 ... [more]
GBB3_TOBAC2.969e-9590.42Guanine nucleotide-binding protein subunit beta OS... [more]
GBB2_TOBAC5.053e-9589.82Guanine nucleotide-binding protein subunit beta-2 ... [more]
GBB_NICPL6.592e-9589.82Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_SOLTU1.122e-9489.22Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_ORYSJ1.929e-8580.84Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_MAIZE3.282e-8580.84Guanine nucleotide-binding protein subunit beta OS... [more]
GBB_ARATH1.266e-8178.33Guanine nucleotide-binding protein subunit beta OS... [more]
GBB1_DANRE4.865e-4152.52Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB1_RAT8.299e-4152.52Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
back to top
BLAST of CD860223 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins)
Total hits: 8
Match NameE-valueIdentityDescription
IMGA|Medtr3g116500.13.030e-9692.78Guanine nucleotide-binding protein subunit beta-1 ... [more]
IMGA|AC148471_14.13.321e-1029.58WD-40 repeat protein (AHRD V1 *-*- B5W1Y6_SPIMA); ... [more]
IMGA|Medtr1g072140.16.264e-927.66WD repeat-containing protein 5 (AHRD V1 ***- Q498M... [more]
IMGA|Medtr5g022690.11.068e-827.64U4/U6 small nuclear ribonucleoprotein PRP4-like pr... [more]
IMGA|Medtr8g106790.13.109e-829.71Guanine nucleotide-binding protein subunit beta-li... [more]
IMGA|Medtr2g012630.13.109e-826.88Katanin p80 WD40-containing subunit B1 (AHRD V1 *-... [more]
IMGA|AC148471_31.12.015e-729.77WD-40 repeat protein (AHRD V1 *--- B5W1Y6_SPIMA); ... [more]
IMGA|Medtr3g052220.17.657e-726.92WD40 repeat-containing protein SMU1 (AHRD V1 ***- ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR19850GUANINE NUCLEOTIDE-BINDING PROTEIN BETA (G PROTEIN BETA)coord: 8..42
score: 7.1
NoneNo IPR availablePANTHERPTHR19850:SF3GUANINE NUCLEOTIDE-BINDING PROTEIN BETA, PLANT (G PROTEIN BETA)coord: 8..42
score: 7.1
NoneNo IPR availableSEGsegsegcoord: 38..55
score
NoneNo IPR availablePANTHERPTHR19850GUANINE NUCLEOTIDE-BINDING PROTEIN BETA (G PROTEIN BETA)coord: 1..164
score: 9.2e
NoneNo IPR availablePANTHERPTHR19850:SF3GUANINE NUCLEOTIDE-BINDING PROTEIN BETA, PLANT (G PROTEIN BETA)coord: 1..164
score: 9.2e
IPR001632G-protein, beta subunitPRINTSPR00319GPROTEINBcoord: 20..36
score: 5.1e-29coord: 39..53
score: 5.1e-29coord: 58..73
score: 5.1e-29coord: 76..93
score: 5.1
IPR001680WD40 repeatSMARTSM00320no descriptioncoord: 13..52
score: 7e-09coord: 55..94
score: 0.0028coord: 104..144
score: 6.5
IPR011046WD40 repeat-like-containing domainSUPERFAMILY50978WD40 repeat-likecoord: 12..156
score: 3.9
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10no descriptioncoord: 15..155
score: 7.2
IPR017986WD40-repeat-containing domainPROFILEPS50294WD_REPEATS_REGIONcoord: 20..164
score: 22
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 39..53
score: NAcoord: 131..145
score
IPR019781WD40 repeat, subgroupPFAMPF00400WD40coord: 16..52
score: 1.2e-09coord: 66..94
score: 0.0018coord: 109..144
score: 2.6
IPR019782WD40 repeat 2PROFILEPS50082WD_REPEATS_2coord: 20..61
score: 14.585coord: 111..153
score: 11

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR19850GUANINE NUCLEOTIDE-BINDING PROTEIN BETA (G PROTEIN BETA)coord: 8..42
score: 7.1
NoneNo IPR availablePANTHERPTHR19850:SF3GUANINE NUCLEOTIDE-BINDING PROTEIN BETA, PLANT (G PROTEIN BETA)coord: 8..42
score: 7.1
NoneNo IPR availableSEGsegsegcoord: 38..55
score
NoneNo IPR availablePANTHERPTHR19850GUANINE NUCLEOTIDE-BINDING PROTEIN BETA (G PROTEIN BETA)coord: 1..164
score: 9.2e
NoneNo IPR availablePANTHERPTHR19850:SF3GUANINE NUCLEOTIDE-BINDING PROTEIN BETA, PLANT (G PROTEIN BETA)coord: 1..164
score: 9.2e
IPR001632G-protein, beta subunitPRINTSPR00319GPROTEINBcoord: 20..36
score: 5.1e-29coord: 39..53
score: 5.1e-29coord: 58..73
score: 5.1e-29coord: 76..93
score: 5.1
IPR001680WD40 repeatSMARTSM00320no descriptioncoord: 13..52
score: 7e-09coord: 55..94
score: 0.0028coord: 104..144
score: 6.5
IPR011046WD40 repeat-like-containing domainSUPERFAMILY50978WD40 repeat-likecoord: 12..156
score: 3.9
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10no descriptioncoord: 15..155
score: 7.2
IPR017986WD40-repeat-containing domainPROFILEPS50294WD_REPEATS_REGIONcoord: 20..164
score: 22
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 39..53
score: NAcoord: 131..145
score
IPR019781WD40 repeat, subgroupPFAMPF00400WD40coord: 16..52
score: 1.2e-09coord: 66..94
score: 0.0018coord: 109..144
score: 2.6
IPR019782WD40 repeat 2PROFILEPS50082WD_REPEATS_2coord: 20..61
score: 14.585coord: 111..153
score: 11

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>CD860223 ID=CD860223|Name=CD860223|organism=Pisum sativum|type=EST|length=620bp
GCCGCCCGGGCAGGTGACAAAATGTCCGTTGCGGAGCTCAAAGAACGTCA
CATAGCAGCGACGGAAACGGTTAATAATCTCAGAGAACGATTGAAGCAGA
GACGGCTTTCTTTGCTTGATACAGATAGTCTCAAGGTAGAGCTCCTGTTA
CTTTTGGTCCCACTGATATTCTTTGCTGTAGAACGCTCCAAGGTCATACC
GGAAAGGTGTATTCATTGGATTGGACTTCAGAAAAGAATAGGATTGTTAG
TGCATCCCAAGATGGAAGATTAATAGTGTGGAATGCTCTAACAAGCCAGA
AAACTCATGCTATAAAGCTTCCTTGTGCATGGGTCATGACGTGTGCTTTC
TCACCAACTGGTCAATCTGTTGCTTGTGGGGGCCTTGACAGTGTTTGCTC
TATTTTCAATCTTAATTCTCCCACTGATAGGGATGGGAATCTAAATGTTT
CACGGATGCTTAGTGGACATAAAGGTTATGTTTCATCTTGTCAGTATGTT
CCAGGTGAAGACACTCACTTAATCACTGGTTCTGGAGATCAGACATGTGT
TTTATGGGATATTACTACTGGCCTTAGAACATCTGTTTTTGGAGGCGAGT
TTCAGTCTGGACATACTGCA
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR001632Gprotein_B
IPR001680WD40_repeat
IPR011046WD40 repeat-like-containing domain
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
IPR019775WD40_repeat_CS
IPR019781WD40 repeat, subgroup
IPR019782WD40 repeat 2