EX569434

EST Overview
NameEX569434
Unique NameEX569434
TypeEST
OrganismPisum sativum (pea)
Sequence length784
Libraries
Library NameType
LIBEST_021973 Pisum sativum shoot apical meristem ESTscdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v2Pisum sativum unigene v2EST
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of EX569434 vs. TrEMBL
Match: C6T2I7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 7.300e-47
Identity = 102/162 (62.96%), Postives = 120/162 (74.07%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPARSNXXXXXXXXXXXXXXXXXXXXNGNEIRQDQIEDGEQMDTS 610
            MKILE N  ALTNFEVLDF+RAKGASKDPTRVIAKV+ SEYKVYDYLV+TAA  QTRES+ E+L S+K+H+L++AEVLN+LNI PAAEVEL+ I+E+   RF DE + EIVELV+K LP   N                     GN+IRQDQ EDGE+MDTS
Sbjct:    1 MKILEGNAGALTNFEVLDFLRAKGASKDPTRVIAKVSQSEYKVYDYLVDTAASVQTRESINEFLRSVKQHDLAKAEVLNILNIGPAAEVELYPILEESDERFGDEGVTEIVELVKKALPLPLN-MKKEEITKGDEETATLKNEKGNKIRQDQNEDGEEMDTS 161          
BLAST of EX569434 vs. TrEMBL
Match: D7TX84_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_84.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00036653001 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.134e-30
Identity = 70/123 (56.91%), Postives = 94/123 (76.42%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPARSN 493
            MKI +AN  ALTNFEVLDF+R++GA+KDPTRVIA +A SE+KVYDYLV +AA +QTRES+ E L   KK++L++AE+LN++NIRPA+ VE+  IIE+   R   E I +++E+V   LP   N
Sbjct:    1 MKIKKANAGALTNFEVLDFLRSRGAAKDPTRVIAPIAASEFKVYDYLVESAACNQTRESINELLEKCKKYDLAKAEILNIINIRPASPVEIDPIIEESEKRM-GEGIEDLIEMVITVLPPPPN 122          
BLAST of EX569434 vs. TrEMBL
Match: B9H4L3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_558454 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 6.209e-30
Identity = 68/119 (57.14%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            MKI   N  ALTNFEVLDF+R++GAS+D +RV+A VA SEYKVYDYLV T A + TRE + E+L   KK++L++AE+LN++NIRP+  VE++ IIE+   RF    I E+VELVE+ LP
Sbjct:    1 MKIKNPNAGALTNFEVLDFLRSRGASRDVSRVLAPVAASEYKVYDYLVETPACNLTREKINEFLERCKKYDLAKAELLNIINIRPSQTVEIYTIIEEMDSRFEMPIIEELVELVEEVLP 119          
BLAST of EX569434 vs. TrEMBL
Match: A5BVZ2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_004802 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 4.450e-28
Identity = 66/119 (55.46%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  137 EANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPARSN 493
            +AN  ALTNFEVLDF+R++GA+KD TRVIA +A SE+KVYDYLV +AA +QTRES+ E L   KK++L++AE+LN++NIRPA+ VE+  IIE+   R   E I +++E+V   LP   N
Sbjct:   26 KANAGALTNFEVLDFLRSRGAAKDXTRVIAPIAASEFKVYDYLVESAACNQTRESINELLEKCKKYDLAKAEILNIINIRPASPVEIDPIIEESEKRM-GEGIEDLIEMVITVLPPPPN 143          
BLAST of EX569434 vs. TrEMBL
Match: Q7XJ61_ARATH (At5g62950 OS=Arabidopsis thaliana GN=At5g62950 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 5.811e-28
Identity = 67/119 (56.30%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 117          
BLAST of EX569434 vs. TrEMBL
Match: Q9FM02_ARATH (Dbj|BAA95748.1 OS=Arabidopsis thaliana PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 2.442e-26
Identity = 64/116 (55.17%), Postives = 87/116 (75.00%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            ++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:   31 VKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 144          
BLAST of EX569434 vs. TrEMBL
Match: D7LAE3_ARALY (Predicted protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_674569 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.583e-25
Identity = 64/116 (55.17%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            ++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRESV ++    K  ++++AE+LN++N+RP++ VEL  IIE    R  D +   I+ELV+  LP
Sbjct:   26 VKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESVTKFADKCKDFKVAKAEILNIINLRPSSIVELLPIIETPDDREIDTD--GILELVKDLLP 139          
BLAST of EX569434 vs. TrEMBL
Match: D7MND0_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_496480 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.699e-25
Identity = 64/119 (53.78%), Postives = 86/119 (72.27%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAE---IVELVEKTLP 481
            ++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRESV ++    K  ++++AE+LN++N+RP++ VEL  IIE      PD+       I+ELV+  LP
Sbjct:    1 MKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESVTKFADKCKDFKVAKAEILNIINLRPSSIVELLPIIET-----PDDRKINTDGILELVKDLLP 114          
BLAST of EX569434 vs. TrEMBL
Match: A8MS47_ARATH (Uncharacterized protein At5g62950.2 OS=Arabidopsis thaliana GN=At5g62950 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 6.014e-25
Identity = 56/91 (61.54%), Postives = 75/91 (82.42%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVEL 397
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVEL 91          
BLAST of EX569434 vs. TrEMBL
Match: Q9FGQ4_ARATH (Genomic DNA, chromosome 3, TAC clone:K5K13 OS=Arabidopsis thaliana GN=At3g28956 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.026e-24
Identity = 63/116 (54.31%), Postives = 85/116 (73.28%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            ++AN  ALTNFE+LDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRESV +     K  +L++AE+LN++N+ P++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:   32 MKANAGALTNFELLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESVNKSADKCKDFKLAKAEILNIINLWPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 145          
BLAST of EX569434 vs. SwissProt
Match: RPC9_BOVIN (DNA-directed RNA polymerase III subunit RPC9 OS=Bos taurus GN=CRCP PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.003e-10
Identity = 37/126 (29.37%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFI------RAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      R +      +     +    Y+   Y+  T    Q+ E V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   R  +E+I  ++  V   LPA
Sbjct:    1 MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCKHQSPEIVREFLTAMKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPA 126          
BLAST of EX569434 vs. SwissProt
Match: RPC9_HUMAN (DNA-directed RNA polymerase III subunit RPC9 OS=Homo sapiens GN=CRCP PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.923e-10
Identity = 37/126 (29.37%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFI------RAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      R +      +     +    Y+   Y+  T    Q+ E V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   R  +E+I  ++  V   LPA
Sbjct:    1 MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPA 126          
BLAST of EX569434 vs. SwissProt
Match: RPC9_CAVPO (DNA-directed RNA polymerase III subunit RPC9 OS=Cavia porcellus GN=CRCP PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.923e-10
Identity = 44/130 (33.85%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSE---------YKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEE-IAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      KD  R   K+  S          Y+   YL  T    Q+ E V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   RF +EE I  ++  V   LPA
Sbjct:    1 MEVKDANSALLSNYEVFQLLTDL---KDQRRESGKMKHSAGQQNLNTITYETLKYLSKTPCRHQSPEIVREFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEETEERFTEEEQIEALLHTVTHILPA 127          
BLAST of EX569434 vs. SwissProt
Match: RPC9_RAT (DNA-directed RNA polymerase III subunit RPC9 OS=Rattus norvegicus GN=Crcp PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.491e-9
Identity = 36/126 (28.57%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFI------RAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      R +      +     +    Y+   Y+  T   +Q+   V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   R  +E+I  ++  V   LPA
Sbjct:    1 MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCKNQSPAIVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPA 126          
BLAST of EX569434 vs. SwissProt
Match: RPC9_MOUSE (DNA-directed RNA polymerase III subunit RPC9 OS=Mus musculus GN=Crcp PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.491e-9
Identity = 36/126 (28.57%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFI------RAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      R +      +     +    Y+   Y+  T   +Q+   V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   R  +E+I  ++  V   LPA
Sbjct:    1 MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCRNQSPAIVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPA 126          
BLAST of EX569434 vs. SwissProt
Match: RPC9_DICDI (DNA-directed RNA polymerase III subunit rpc9 OS=Dictyostelium discoideum GN=rpc9 PE=3 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.648e-8
Identity = 42/121 (34.71%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  125 MKILEANVSAL-TNFEVLDFIRAKGASKDPTRVIAKVAMSEY--KVYDYLVNTAAGSQTRESVKEYLTSIKKH------ELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVE 460
            MKI++ +   + TNFEVL  ++ K       R+  +V ++E+   V  YL  T A  QT ESVKE   S+ K       ++   E+L +LNI P++EVE+  +IEDC  R   +E+ + ++
Sbjct:    1 MKIIKKDKEEIITNFEVLQLLKHK------RRIEEQVLLNEFVNNVIRYLETTPASKQTIESVKECKKSVTKLADTSGCKILTGEMLQILNIAPSSEVEVHLVIEDCEDRIDAKEVLKEIK 115          
BLAST of EX569434 vs. TAIR peptide
Match: AT5G62950.3 (| Symbols: | RNA polymerase II, Rpb4, core protein | chr5:25262355-25263033 REVERSE LENGTH=139)

HSP 1 Score: 128.642 bits (322), Expect = 3.756e-30
Identity = 67/119 (56.30%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 117          
BLAST of EX569434 vs. TAIR peptide
Match: AT5G62950.1 (| Symbols: | RNA polymerase II, Rpb4, core protein | chr5:25262355-25263033 REVERSE LENGTH=139)

HSP 1 Score: 128.642 bits (322), Expect = 3.756e-30
Identity = 67/119 (56.30%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 117          
BLAST of EX569434 vs. TAIR peptide
Match: AT5G62950.2 (| Symbols: | RNA polymerase II, Rpb4, core protein | chr5:25262447-25263033 REVERSE LENGTH=106)

HSP 1 Score: 118.627 bits (296), Expect = 3.886e-27
Identity = 56/91 (61.54%), Postives = 75/91 (82.42%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVEL 397
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVEL 91          
BLAST of EX569434 vs. TAIR peptide
Match: AT3G28956.1 (| Symbols: | RNA polymerase II, Rpb4, core protein | chr3:10980789-10981380 REVERSE LENGTH=137)

HSP 1 Score: 117.857 bits (294), Expect = 6.629e-27
Identity = 63/116 (54.31%), Postives = 85/116 (73.28%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            ++AN  ALTNFE+LDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRESV +     K  +L++AE+LN++N+ P++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:    1 MKANAGALTNFELLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESVNKSADKCKDFKLAKAEILNIINLWPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 114          
BLAST of EX569434 vs. TAIR peptide
Match: AT5G62950.3 (| Symbols: | RNA polymerase II, Rpb4, core protein | chr5:25262355-25263033 REVERSE LENGTH=139)

HSP 1 Score: 128.642 bits (322), Expect = 3.756e-30
Identity = 67/119 (56.30%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 117          
BLAST of EX569434 vs. TAIR peptide
Match: AT5G62950.1 (| Symbols: | RNA polymerase II, Rpb4, core protein | chr5:25262355-25263033 REVERSE LENGTH=139)

HSP 1 Score: 128.642 bits (322), Expect = 3.756e-30
Identity = 67/119 (56.30%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 117          
BLAST of EX569434 vs. TAIR peptide
Match: AT5G62950.2 (| Symbols: | RNA polymerase II, Rpb4, core protein | chr5:25262447-25263033 REVERSE LENGTH=106)

HSP 1 Score: 118.627 bits (296), Expect = 3.886e-27
Identity = 56/91 (61.54%), Postives = 75/91 (82.42%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVEL 397
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVEL 91          
BLAST of EX569434 vs. TAIR peptide
Match: AT3G28956.1 (| Symbols: | RNA polymerase II, Rpb4, core protein | chr3:10980789-10981380 REVERSE LENGTH=137)

HSP 1 Score: 117.857 bits (294), Expect = 6.629e-27
Identity = 63/116 (54.31%), Postives = 85/116 (73.28%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            ++AN  ALTNFE+LDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRESV +     K  +L++AE+LN++N+ P++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:    1 MKANAGALTNFELLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESVNKSADKCKDFKLAKAEILNIINLWPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 114          
BLAST of EX569434 vs. TrEMBL
Match: C6T2I7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 8.889e-47
Identity = 102/162 (62.96%), Postives = 120/162 (74.07%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPARSNXXXXXXXXXXXXXXXXXXXXNGNEIRQDQIEDGEQMDTS 610
            MKILE N  ALTNFEVLDF+RAKGASKDPTRVIAKV+ SEYKVYDYLV+TAA  QTRES+ E+L S+K+H+L++AEVLN+LNI PAAEVEL+ I+E+   RF DE + EIVELV+K LP   N                     GN+IRQDQ EDGE+MDTS
Sbjct:    1 MKILEGNAGALTNFEVLDFLRAKGASKDPTRVIAKVSQSEYKVYDYLVDTAASVQTRESINEFLRSVKQHDLAKAEVLNILNIGPAAEVELYPILEESDERFGDEGVTEIVELVKKALPLPLN-MKKEEITKGDEETATLKNEKGNKIRQDQNEDGEEMDTS 161          
BLAST of EX569434 vs. TrEMBL
Match: D7TX84_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_84.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00036653001 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.598e-30
Identity = 70/123 (56.91%), Postives = 94/123 (76.42%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPARSN 493
            MKI +AN  ALTNFEVLDF+R++GA+KDPTRVIA +A SE+KVYDYLV +AA +QTRES+ E L   KK++L++AE+LN++NIRPA+ VE+  IIE+   R   E I +++E+V   LP   N
Sbjct:    1 MKIKKANAGALTNFEVLDFLRSRGAAKDPTRVIAPIAASEFKVYDYLVESAACNQTRESINELLEKCKKYDLAKAEILNIINIRPASPVEIDPIIEESEKRM-GEGIEDLIEMVITVLPPPPN 122          
BLAST of EX569434 vs. TrEMBL
Match: B9H4L3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_558454 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 7.560e-30
Identity = 68/119 (57.14%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            MKI   N  ALTNFEVLDF+R++GAS+D +RV+A VA SEYKVYDYLV T A + TRE + E+L   KK++L++AE+LN++NIRP+  VE++ IIE+   RF    I E+VELVE+ LP
Sbjct:    1 MKIKNPNAGALTNFEVLDFLRSRGASRDVSRVLAPVAASEYKVYDYLVETPACNLTREKINEFLERCKKYDLAKAELLNIINIRPSQTVEIYTIIEEMDSRFEMPIIEELVELVEEVLP 119          
BLAST of EX569434 vs. TrEMBL
Match: A5BVZ2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_004802 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.418e-28
Identity = 66/119 (55.46%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  137 EANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPARSN 493
            +AN  ALTNFEVLDF+R++GA+KD TRVIA +A SE+KVYDYLV +AA +QTRES+ E L   KK++L++AE+LN++NIRPA+ VE+  IIE+   R   E I +++E+V   LP   N
Sbjct:   26 KANAGALTNFEVLDFLRSRGAAKDXTRVIAPIAASEFKVYDYLVESAACNQTRESINELLEKCKKYDLAKAEILNIINIRPASPVEIDPIIEESEKRM-GEGIEDLIEMVITVLPPPPN 143          
BLAST of EX569434 vs. TrEMBL
Match: Q7XJ61_ARATH (At5g62950 OS=Arabidopsis thaliana GN=At5g62950 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 7.076e-28
Identity = 67/119 (56.30%), Postives = 90/119 (75.63%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 117          
BLAST of EX569434 vs. TrEMBL
Match: Q9FM02_ARATH (Dbj|BAA95748.1 OS=Arabidopsis thaliana PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 2.973e-26
Identity = 64/116 (55.17%), Postives = 87/116 (75.00%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            ++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:   31 VKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 144          
BLAST of EX569434 vs. TrEMBL
Match: D7LAE3_ARALY (Predicted protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_674569 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.927e-25
Identity = 64/116 (55.17%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            ++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRESV ++    K  ++++AE+LN++N+RP++ VEL  IIE    R  D +   I+ELV+  LP
Sbjct:   26 VKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESVTKFADKCKDFKVAKAEILNIINLRPSSIVELLPIIETPDDREIDTD--GILELVKDLLP 139          
BLAST of EX569434 vs. TrEMBL
Match: D7MND0_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_496480 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 3.287e-25
Identity = 64/119 (53.78%), Postives = 86/119 (72.27%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAE---IVELVEKTLP 481
            ++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRESV ++    K  ++++AE+LN++N+RP++ VEL  IIE      PD+       I+ELV+  LP
Sbjct:    1 MKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESVTKFADKCKDFKVAKAEILNIINLRPSSIVELLPIIET-----PDDRKINTDGILELVKDLLP 114          
BLAST of EX569434 vs. TrEMBL
Match: A8MS47_ARATH (Uncharacterized protein At5g62950.2 OS=Arabidopsis thaliana GN=At5g62950 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 7.322e-25
Identity = 56/91 (61.54%), Postives = 75/91 (82.42%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVEL 397
            MKI++AN  ALTNFEVLDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRES+ ++    K  +L++AE+LN++N+RP++ VEL
Sbjct:    1 MKIVKANAGALTNFEVLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESINKFADKCKDFKLAKAEILNIINLRPSSIVEL 91          
BLAST of EX569434 vs. TrEMBL
Match: Q9FGQ4_ARATH (Genomic DNA, chromosome 3, TAC clone:K5K13 OS=Arabidopsis thaliana GN=At3g28956 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.249e-24
Identity = 63/116 (54.31%), Postives = 85/116 (73.28%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLP 481
            ++AN  ALTNFE+LDF+ ++GASKD TRVIA +A SEYKVYDYLV TAA +QTRESV +     K  +L++AE+LN++N+ P++ VEL  IIE+   R  D +   I+ELV+  LP
Sbjct:   32 MKANAGALTNFELLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESVNKSADKCKDFKLAKAEILNIINLWPSSIVELLPIIENLDDREIDTD--GILELVKDLLP 145          
BLAST of EX569434 vs. Lotus protein
Match: chr6.CM2021.50.r2.m (- phase: 0 )

HSP 1 Score: 202.601 bits (514), Expect = 1.183e-52
Identity = 103/161 (63.98%), Postives = 121/161 (75.16%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPARSNXXXXXXXXXXXXXXXXXXXXNGNEIRQDQIEDGEQMDT 607
            MKILEAN  ALTNFEVLDF+R KGASKDPTRVIAKVA SEYKVYDYLVNTAA +QTRES+ E++ S+KKH+L++AEVLN++NIRPAA VE+F IIE+C  RFPDEE+ EIVELV+KTLPA                       N  ++ +DQ E GEQMDT
Sbjct:    1 MKILEANAGALTNFEVLDFLRGKGASKDPTRVIAKVAQSEYKVYDYLVNTAASNQTRESINEFMASVKKHDLAKAEVLNIINIRPAAAVEMFPIIEECESRFPDEEVTEIVELVKKTLPAPPAKKNVVENPEGNEETATLEHENDTKMSEDQNEGGEQMDT 161          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma18g04460.1|PACid:16307903 ()

HSP 1 Score: 143.28 bits (360), Expect = 2.242e-34
Identity = 70/89 (78.65%), Postives = 81/89 (91.01%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELF 400
            LE N  ALTNFEVLDF+RAKGASKDPTRVIAKVA SEYKVYDYLV+TAA  QTRES+ E+LTS+K+H+L++AEVLN+LNI PAAEVEL+
Sbjct:    1 LECNAGALTNFEVLDFLRAKGASKDPTRVIAKVAQSEYKVYDYLVDTAASVQTRESINEFLTSVKQHDLAKAEVLNILNIGPAAEVELY 89          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma05g22850.1|PACid:16259337 ()

HSP 1 Score: 135.576 bits (340), Expect = 4.675e-32
Identity = 65/89 (73.03%), Postives = 77/89 (86.52%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELF 400
            LE NV ALTNFEVLDF+RAKGASKDPTRVI KVA SEYKVYDYLVNT A  QTRES+ E+LTS+K+++L++ EVLN+LNI P A+ EL+
Sbjct:    1 LEGNVGALTNFEVLDFLRAKGASKDPTRVITKVAQSEYKVYDYLVNTPASIQTRESINEFLTSVKQYDLAKVEVLNILNIEPVADFELY 89          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma18g36530.1|PACid:16309788 ()

HSP 1 Score: 129.028 bits (323), Expect = 4.376e-30
Identity = 62/89 (69.66%), Postives = 75/89 (84.27%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELF 400
            LE N  ALTNFEVLDF++AKGASKDPTRVIAKVA  EYK YDYLV+ AA   TRES+ E+LTS+K+H+L++AE LN+LNI PAA+ EL+
Sbjct:    1 LEGNAGALTNFEVLDFLQAKGASKDPTRVIAKVAQFEYKAYDYLVDIAASVHTRESINEFLTSVKQHDLAKAEALNILNIGPAADFELY 89          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma08g37970.1|PACid:16273116 ()

HSP 1 Score: 124.02 bits (310), Expect = 1.408e-28
Identity = 60/89 (67.42%), Postives = 74/89 (83.15%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELF 400
            LE N  AL NFEVLDF+RAKGAS+DPTRVIAK+   EYKVYDYLV+T A  QTRES+ E+LTS+K+++L++AE LN+LNI PAA  EL+
Sbjct:    1 LEGNAGALINFEVLDFLRAKGASQDPTRVIAKLPQFEYKVYDYLVDTVASVQTRESINEFLTSVKQYDLAKAEALNILNIGPAAYFELY 89          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma18g34290.1|PACid:16309595 ()

HSP 1 Score: 122.094 bits (305), Expect = 5.349e-28
Identity = 61/86 (70.93%), Postives = 72/86 (83.72%), Query Frame = 2
Query:  143 NVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELF 400
            N  ALTNFEVL F+RAKGASKDPTRV AKVA  EYKVYDYLV+TAA  QTRES+ E LTS+K+H+L++ EVLN+LNI  AA+ EL+
Sbjct:    2 NAGALTNFEVLHFLRAKGASKDPTRVNAKVAQFEYKVYDYLVDTAASIQTRESINELLTSVKQHDLAKTEVLNILNIGLAADFELY 87          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma18g34610.1|PACid:16309625 ()

HSP 1 Score: 109.768 bits (273), Expect = 2.747e-24
Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIK 328
            LE N SALTNFEVLDF+RAKGASKDPTRVIAKVA SEYKVYDYLV+TAA  QTRES+ E+LTS+K
Sbjct:    1 LEGNASALTNFEVLDFLRAKGASKDPTRVIAKVAQSEYKVYDYLVDTAASVQTRESINEFLTSVK 65          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma18g34710.1|PACid:16309634 ()

HSP 1 Score: 107.842 bits (268), Expect = 1.044e-23
Identity = 53/65 (81.54%), Postives = 59/65 (90.77%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIK 328
            LE N SALTNFEVLDF+RAKGASKDPTRVIAKVA SEYKV+DYLV+TAA  QTRES+ E+LTS+K
Sbjct:    1 LEGNASALTNFEVLDFLRAKGASKDPTRVIAKVAQSEYKVHDYLVDTAASVQTRESINEFLTSVK 65          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma18g34550.1|PACid:16309620 ()

HSP 1 Score: 107.842 bits (268), Expect = 1.044e-23
Identity = 54/76 (71.05%), Postives = 62/76 (81.58%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLN 361
            LE N SALTNFEVLDF+RAKGASKDPT VIAKVA SEYKVYDYLV+TAA  QTRES+ E+LTS+K     + E ++
Sbjct:    1 LEGNASALTNFEVLDFLRAKGASKDPTGVIAKVAQSEYKVYDYLVDTAASIQTRESINEFLTSVKYEYFYKGEFMH 76          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma18g34350.1|PACid:16309601 ()

HSP 1 Score: 107.457 bits (267), Expect = 1.363e-23
Identity = 55/89 (61.80%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  134 LEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELF 400
            LE N  ALTNFEVLDF+RAKGASKDPTRVIAKVA SEYKVYDYL           S+ E+LT +K+++L++ E LN+LNI  AA+ EL+
Sbjct:    1 LEGNAGALTNFEVLDFLRAKGASKDPTRVIAKVAQSEYKVYDYL-----------SINEFLTRVKQYDLAKVEALNILNIGSAADFELY 78          
BLAST of EX569434 vs. Soybean peptides
Match: Glyma08g38000.1|PACid:16273119 ()

HSP 1 Score: 107.071 bits (266), Expect = 1.781e-23
Identity = 56/87 (64.37%), Postives = 65/87 (74.71%), Query Frame = 2
Query:  140 ANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELF 400
            AN   LTNFEVLDF+R+KGASKDPT VIAKVA SEYKVYDYLV+TAA  QTRES  E+LTS           +N+LNI P+A+ EL+
Sbjct:    1 ANAGPLTNFEVLDFLRSKGASKDPTSVIAKVAQSEYKVYDYLVDTAASVQTRESTNEFLTS----------AMNILNIGPSADFELY 77          
BLAST of EX569434 vs. SwissProt
Match: RPC9_BOVIN (DNA-directed RNA polymerase III subunit RPC9 OS=Bos taurus GN=CRCP PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.058e-10
Identity = 37/126 (29.37%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFI------RAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      R +      +     +    Y+   Y+  T    Q+ E V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   R  +E+I  ++  V   LPA
Sbjct:    1 MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCKHQSPEIVREFLTAMKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPA 126          
BLAST of EX569434 vs. SwissProt
Match: RPC9_HUMAN (DNA-directed RNA polymerase III subunit RPC9 OS=Homo sapiens GN=CRCP PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.994e-10
Identity = 37/126 (29.37%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFI------RAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      R +      +     +    Y+   Y+  T    Q+ E V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   R  +E+I  ++  V   LPA
Sbjct:    1 MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPA 126          
BLAST of EX569434 vs. SwissProt
Match: RPC9_CAVPO (DNA-directed RNA polymerase III subunit RPC9 OS=Cavia porcellus GN=CRCP PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.994e-10
Identity = 44/130 (33.85%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFIRAKGASKDPTRVIAKVAMSE---------YKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEE-IAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      KD  R   K+  S          Y+   YL  T    Q+ E V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   RF +EE I  ++  V   LPA
Sbjct:    1 MEVKDANSALLSNYEVFQLLTDL---KDQRRESGKMKHSAGQQNLNTITYETLKYLSKTPCRHQSPEIVREFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEETEERFTEEEQIEALLHTVTHILPA 127          
BLAST of EX569434 vs. SwissProt
Match: RPC9_RAT (DNA-directed RNA polymerase III subunit RPC9 OS=Rattus norvegicus GN=Crcp PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.518e-9
Identity = 36/126 (28.57%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFI------RAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      R +      +     +    Y+   Y+  T   +Q+   V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   R  +E+I  ++  V   LPA
Sbjct:    1 MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCKNQSPAIVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPA 126          
BLAST of EX569434 vs. SwissProt
Match: RPC9_MOUSE (DNA-directed RNA polymerase III subunit RPC9 OS=Mus musculus GN=Crcp PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.518e-9
Identity = 36/126 (28.57%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  125 MKILEANVSALTNFEVLDFI------RAKGASKDPTRVIAKVAMSEYKVYDYLVNTAAGSQTRESVKEYLTSIKKHELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVELVEKTLPA 484
            M++ +AN + L+N+EV   +      R +      +     +    Y+   Y+  T   +Q+   V+E+LT++K H+L++AE L +LN RP   VE+  ++E+   R  +E+I  ++  V   LPA
Sbjct:    1 MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCRNQSPAIVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPA 126          
BLAST of EX569434 vs. SwissProt
Match: RPC9_DICDI (DNA-directed RNA polymerase III subunit rpc9 OS=Dictyostelium discoideum GN=rpc9 PE=3 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.678e-8
Identity = 42/121 (34.71%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  125 MKILEANVSAL-TNFEVLDFIRAKGASKDPTRVIAKVAMSEY--KVYDYLVNTAAGSQTRESVKEYLTSIKKH------ELSQAEVLNVLNIRPAAEVELFHIIEDCTVRFPDEEIAEIVE 460
            MKI++ +   + TNFEVL  ++ K       R+  +V ++E+   V  YL  T A  QT ESVKE   S+ K       ++   E+L +LNI P++EVE+  +IEDC  R   +E+ + ++
Sbjct:    1 MKIIKKDKEEIITNFEVLQLLKHK------RRIEEQVLLNEFVNNVIRYLETTPASKQTIESVKECKKSVTKLADTSGCKILTGEMLQILNIAPSSEVEVHLVIEDCEDRIDAKEVLKEIK 115          
The following BLAST results are available for this feature:
BLAST of EX569434 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6T2I7_SOYBN7.300e-4762.96Putative uncharacterized protein OS=Glycine max PE... [more]
D7TX84_VITVI2.134e-3056.91Whole genome shotgun sequence of line PN40024, sca... [more]
B9H4L3_POPTR6.209e-3057.14Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A5BVZ2_VITVI4.450e-2855.46Putative uncharacterized protein OS=Vitis vinifera... [more]
Q7XJ61_ARATH5.811e-2856.30At5g62950 OS=Arabidopsis thaliana GN=At5g62950 PE=... [more]
Q9FM02_ARATH2.442e-2655.17Dbj|BAA95748.1 OS=Arabidopsis thaliana PE=4 SV=1[more]
D7LAE3_ARALY1.583e-2555.17Predicted protein OS=Arabidopsis lyrata subsp. lyr... [more]
D7MND0_ARALY2.699e-2553.78Putative uncharacterized protein OS=Arabidopsis ly... [more]
A8MS47_ARATH6.014e-2561.54Uncharacterized protein At5g62950.2 OS=Arabidopsis... [more]
Q9FGQ4_ARATH1.026e-2454.31Genomic DNA, chromosome 3, TAC clone:K5K13 OS=Arab... [more]
back to top
BLAST of EX569434 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 6
Match NameE-valueIdentityDescription
RPC9_BOVIN3.003e-1029.37DNA-directed RNA polymerase III subunit RPC9 OS=Bo... [more]
RPC9_HUMAN3.923e-1029.37DNA-directed RNA polymerase III subunit RPC9 OS=Ho... [more]
RPC9_CAVPO3.923e-1033.85DNA-directed RNA polymerase III subunit RPC9 OS=Ca... [more]
RPC9_RAT1.491e-928.57DNA-directed RNA polymerase III subunit RPC9 OS=Ra... [more]
RPC9_MOUSE1.491e-928.57DNA-directed RNA polymerase III subunit RPC9 OS=Mu... [more]
RPC9_DICDI1.648e-834.71DNA-directed RNA polymerase III subunit rpc9 OS=Di... [more]
back to top
BLAST of EX569434 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 4
Match NameE-valueIdentityDescription
AT5G62950.33.756e-3056.30| Symbols: | RNA polymerase II, Rpb4, core protei... [more]
AT5G62950.13.756e-3056.30| Symbols: | RNA polymerase II, Rpb4, core protei... [more]
AT5G62950.23.886e-2761.54| Symbols: | RNA polymerase II, Rpb4, core protei... [more]
AT3G28956.16.629e-2754.31| Symbols: | RNA polymerase II, Rpb4, core protei... [more]
back to top
BLAST of EX569434 vs. TAIR peptide
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs TAIR 10 peptide)
Total hits: 4
Match NameE-valueIdentityDescription
AT5G62950.33.756e-3056.30| Symbols: | RNA polymerase II, Rpb4, core protei... [more]
AT5G62950.13.756e-3056.30| Symbols: | RNA polymerase II, Rpb4, core protei... [more]
AT5G62950.23.886e-2761.54| Symbols: | RNA polymerase II, Rpb4, core protei... [more]
AT3G28956.16.629e-2754.31| Symbols: | RNA polymerase II, Rpb4, core protei... [more]
back to top
BLAST of EX569434 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
C6T2I7_SOYBN8.889e-4762.96Putative uncharacterized protein OS=Glycine max PE... [more]
D7TX84_VITVI2.598e-3056.91Whole genome shotgun sequence of line PN40024, sca... [more]
B9H4L3_POPTR7.560e-3057.14Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
A5BVZ2_VITVI5.418e-2855.46Putative uncharacterized protein OS=Vitis vinifera... [more]
Q7XJ61_ARATH7.076e-2856.30At5g62950 OS=Arabidopsis thaliana GN=At5g62950 PE=... [more]
Q9FM02_ARATH2.973e-2655.17Dbj|BAA95748.1 OS=Arabidopsis thaliana PE=4 SV=1[more]
D7LAE3_ARALY1.927e-2555.17Predicted protein OS=Arabidopsis lyrata subsp. lyr... [more]
D7MND0_ARALY3.287e-2553.78Putative uncharacterized protein OS=Arabidopsis ly... [more]
A8MS47_ARATH7.322e-2561.54Uncharacterized protein At5g62950.2 OS=Arabidopsis... [more]
Q9FGQ4_ARATH1.249e-2454.31Genomic DNA, chromosome 3, TAC clone:K5K13 OS=Arab... [more]
back to top
BLAST of EX569434 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins)
Total hits: 1
Match NameE-valueIdentityDescription
chr6.CM2021.50.r2.m1.183e-5263.98- phase: 0 [more]
back to top
BLAST of EX569434 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides)
Total hits: 10
Match NameE-valueIdentityDescription
Glyma18g04460.1|PACid:163079032.242e-3478.65[more]
Glyma05g22850.1|PACid:162593374.675e-3273.03[more]
Glyma18g36530.1|PACid:163097884.376e-3069.66[more]
Glyma08g37970.1|PACid:162731161.408e-2867.42[more]
Glyma18g34290.1|PACid:163095955.349e-2870.93[more]
Glyma18g34610.1|PACid:163096252.747e-2483.08[more]
Glyma18g34710.1|PACid:163096341.044e-2381.54[more]
Glyma18g34550.1|PACid:163096201.044e-2371.05[more]
Glyma18g34350.1|PACid:163096011.363e-2361.80[more]
Glyma08g38000.1|PACid:162731191.781e-2364.37[more]
back to top
BLAST of EX569434 vs. SwissProt
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Swissprot)
Total hits: 6
Match NameE-valueIdentityDescription
RPC9_BOVIN3.058e-1029.37DNA-directed RNA polymerase III subunit RPC9 OS=Bo... [more]
RPC9_HUMAN3.994e-1029.37DNA-directed RNA polymerase III subunit RPC9 OS=Ho... [more]
RPC9_CAVPO3.994e-1033.85DNA-directed RNA polymerase III subunit RPC9 OS=Ca... [more]
RPC9_RAT1.518e-928.57DNA-directed RNA polymerase III subunit RPC9 OS=Ra... [more]
RPC9_MOUSE1.518e-928.57DNA-directed RNA polymerase III subunit RPC9 OS=Mu... [more]
RPC9_DICDI1.678e-834.71DNA-directed RNA polymerase III subunit rpc9 OS=Di... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005574RNA polymerase II, Rpb4PFAMPF03874RNA_pol_Rpb4coord: 51..158
score: 2
IPR006590RNA polymerase II, Rpb4, coreSMARTSM00657no descriptioncoord: 42..162
score: 9.6
IPR010997HRDC-likeSUPERFAMILY47819HRDC-likecoord: 36..163
score: 2.6
NoneNo IPR availablePANTHERPTHR15561CALCITONIN GENE-RELATED PEPTIDE-RECEPTOR COMPONENT PROTEINcoord: 32..187
score: 8.9
NoneNo IPR availableSEGsegsegcoord: 165..184
score
NoneNo IPR availableSEGsegsegcoord: 8..28
score: NAcoord: 37..48
score
NoneNo IPR availableSEGsegsegcoord: 45..56
score

Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005574RNA polymerase II, Rpb4PFAMPF03874RNA_pol_Rpb4coord: 51..158
score: 2
IPR006590RNA polymerase II, Rpb4, coreSMARTSM00657no descriptioncoord: 42..162
score: 9.6
IPR010997HRDC-likeSUPERFAMILY47819HRDC-likecoord: 36..163
score: 2.6
NoneNo IPR availablePANTHERPTHR15561CALCITONIN GENE-RELATED PEPTIDE-RECEPTOR COMPONENT PROTEINcoord: 32..187
score: 8.9
NoneNo IPR availableSEGsegsegcoord: 165..184
score
NoneNo IPR availableSEGsegsegcoord: 8..28
score: NAcoord: 37..48
score
NoneNo IPR availableSEGsegsegcoord: 45..56
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v2
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>EX569434 ID=EX569434|Name=EX569434|organism=Pisum sativum|type=EST|length=784bp
CGCGCGCCCTTCCGCCAAACTCGCCGCCTATTCGCCGCAGTTCCAACCAA
CACAGCCGAAGTTCTTCGTTGCTAGGAAGGAAGGAAGGCCGCCGGATAAA
GAGAGACATTATTTGCTGCAAGAGATGAAAATCTTGGAGGCCAATGTTTC
TGCACTTACAAATTTTGAGGTCCTTGATTTCATACGAGCTAAAGGAGCTT
CAAAAGATCCAACACGGGTTATTGCCAAAGTAGCAATGTCCGAATACAAG
GTTTACGATTATTTAGTTAATACTGCAGCTGGTAGTCAAACAAGAGAGAG
CGTCAAAGAATATTTGACAAGTATTAAAAAGCATGAGCTGTCACAGGCTG
AGGTTCTGAATGTATTAAACATCAGACCAGCTGCCGAAGTGGAATTATTT
CATATTATAGAGGATTGTACTGTCCGTTTTCCAGATGAAGAGATAGCTGA
AATAGTAGAACTGGTAGAAAAAACATTACCAGCACGATCTAACGAAGAGA
CATCAAAAGAAATCTCCGAGGGCGAAGAAGAAACTGAAACACAGAAATAT
GAAAATGGTAACGAGATTAGGCAAGATCAAATTGAAGATGGAGAACAAAT
GGACACAAGTTGAGATTTCATTTTAGTACTTAATGACTAGCACTAGAAGA
TCTCGTTGTTGGGTTAAAAAAATGAGTTGACGAACATGATTTTTATACGA
ACCTGAGTTAGTCCCGTGGCTGTGTTACTTCTACAGGAAACTTAAGAAAA
GCAAATGCAATGCAAATGCTGTTGGCTTTGTTAC
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Molecular Function
TermDefinition
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0000166nucleotide binding
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0006350transcription
GO:0044237cellular metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR005574RPB4/RPC9
IPR006590RNA_pol_Rpb4/RPC9_core
IPR010997HRDC-like_sf