EX569643
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EX569643 vs. TrEMBL
Match: Q2IB41_EUCGR (Cellulose synthase 3 OS=Eucalyptus grandis GN=CesA3 PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 2.759e-14 Identity = 38/39 (97.44%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTK CGINC Sbjct: 1002 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKKCGINC 1040
BLAST of EX569643 vs. TrEMBL
Match: D0G0A6_EUCGG (Cellulose synthase catalytic subunit OS=Eucalyptus globulus subsp. globulus GN=CesA PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 2.759e-14 Identity = 38/39 (97.44%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTK CGINC Sbjct: 1003 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKKCGINC 1041
BLAST of EX569643 vs. TrEMBL
Match: A8R7F0_EUCGL (Cellulose synthase catalytic subunit OS=Eucalyptus globulus GN=CesA PE=4 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 2.759e-14 Identity = 38/39 (97.44%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTK CGINC Sbjct: 1003 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKKCGINC 1041
BLAST of EX569643 vs. TrEMBL
Match: B9T4Q9_RICCO (Cellulose synthase A catalytic subunit 3 [UDP-forming], putative OS=Ricinus communis GN=RCOM_0443860 PE=4 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 4.706e-14 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPFV+KTKGPDTK CGINC Sbjct: 939 IVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 977
BLAST of EX569643 vs. TrEMBL
Match: B9HB43_POPTR (Cellulose synthase OS=Populus trichocarpa GN=POPTRDRAFT_717644 PE=4 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 4.706e-14 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPFV+KTKGPDTK CGINC Sbjct: 989 IVVIWSVLLASIFSLLWVRIDPFVMKTKGPDTKQCGINC 1027
BLAST of EX569643 vs. TrEMBL
Match: B8XPP5_9ROSI (Cellulose synthase OS=Betula luminifera GN=CesA3 PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 4.706e-14 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWS+LLASIFSLLWVRIDPFVLKTKGPDTK CGINC Sbjct: 1003 IVVIWSILLASIFSLLWVRIDPFVLKTKGPDTKNCGINC 1041
BLAST of EX569643 vs. TrEMBL
Match: B2LWM1_9ROSI (Cellulose synthase OS=Betula platyphylla GN=CesA3 PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 4.706e-14 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWS+LLASIFSLLWVRIDPFVLKTKGPDTK CGINC Sbjct: 1002 IVVIWSILLASIFSLLWVRIDPFVLKTKGPDTKNCGINC 1040
BLAST of EX569643 vs. TrEMBL
Match: D7LX04_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_909737 PE=4 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 1.048e-13 Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDT CGINC Sbjct: 987 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTSKCGINC 1025
BLAST of EX569643 vs. TrEMBL
Match: D7U1D5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_37.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00023643001 PE=4 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 1.369e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPF+LKTKGPD K CGINC Sbjct: 999 IVVIWSVLLASIFSLLWVRIDPFILKTKGPDVKQCGINC 1037
BLAST of EX569643 vs. TrEMBL
Match: A5ARG8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_013112 PE=4 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 1.369e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPF+LKTKGPD K CGINC Sbjct: 986 IVVIWSVLLASIFSLLWVRIDPFILKTKGPDVKQCGINC 1024
BLAST of EX569643 vs. SwissProt
Match: CESA7_ARATH (Cellulose synthase A catalytic subunit 7 [UDP-forming] OS=Arabidopsis thaliana GN=CESA7 PE=1 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.133e-15 Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDT CGINC Sbjct: 988 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTSKCGINC 1026
BLAST of EX569643 vs. SwissProt
Match: CESA9_ORYSJ (Cellulose synthase A catalytic subunit 9 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA9 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.805e-13 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPF +K +GPD + CGINC Sbjct: 1017 IVVIWSVLLASIFSLLWVRIDPFTIKARGPDVRQCGINC 1055
BLAST of EX569643 vs. SwissProt
Match: CESA9_ORYSI (Cellulose synthase A catalytic subunit 9 [UDP-forming] OS=Oryza sativa subsp. indica GN=CESA9 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.805e-13 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPF +K +GPD + CGINC Sbjct: 1017 IVVIWSVLLASIFSLLWVRIDPFTIKARGPDVRQCGINC 1055
BLAST of EX569643 vs. SwissProt
Match: CESA8_ORYSJ (Probable cellulose synthase A catalytic subunit 8 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA8 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.312e-12 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVV+W++LLASIFSLLWVRIDPF + GPDT+ CGINC Sbjct: 1043 IVVVWAILLASIFSLLWVRIDPFTTRVTGPDTQTCGINC 1081
BLAST of EX569643 vs. SwissProt
Match: CESA2_ORYSJ (Probable cellulose synthase A catalytic subunit 2 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA2 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.938e-12 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVV+W++LLASIFSLLWVRIDPF + GPDT+ CGINC Sbjct: 1035 IVVVWAILLASIFSLLWVRIDPFTTRVTGPDTQKCGINC 1073
BLAST of EX569643 vs. SwissProt
Match: CESA2_ORYSI (Probable cellulose synthase A catalytic subunit 2 [UDP-forming] OS=Oryza sativa subsp. indica GN=CESA2 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.938e-12 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVV+W++LLASIFSLLWVRIDPF + GPDT+ CGINC Sbjct: 1035 IVVVWAILLASIFSLLWVRIDPFTTRVTGPDTQKCGINC 1073
BLAST of EX569643 vs. SwissProt
Match: CESA3_ARATH (Cellulose synthase A catalytic subunit 3 [UDP-forming] OS=Arabidopsis thaliana GN=CESA3 PE=1 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 4.497e-11 Identity = 30/39 (76.92%), Postives = 32/39 (82.05%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVV+WSVLLASIFSLLWVRIDPF + GPD CGINC Sbjct: 1027 IVVVWSVLLASIFSLLWVRIDPFTSRVTGPDILECGINC 1065
BLAST of EX569643 vs. SwissProt
Match: CESA7_ORYSJ (Cellulose synthase A catalytic subunit 7 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA7 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 1.002e-10 Identity = 28/39 (71.79%), Postives = 34/39 (87.18%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVV+WS+LLASIFSL+WVRIDPF+ K KGP K CG++C Sbjct: 1025 IVVLWSILLASIFSLVWVRIDPFIPKPKGPVLKPCGVSC 1063
BLAST of EX569643 vs. SwissProt
Match: CESA6_ORYSJ (Probable cellulose synthase A catalytic subunit 6 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA6 PE=2 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 6.494e-10 Identity = 26/39 (66.67%), Postives = 33/39 (84.62%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IV++WS+LLASIFSLLWVRIDPF+ K GP + CG++C Sbjct: 1053 IVIVWSILLASIFSLLWVRIDPFLAKNNGPLLEECGLDC 1091
BLAST of EX569643 vs. SwissProt
Match: CESA5_ORYSJ (Probable cellulose synthase A catalytic subunit 5 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA5 PE=2 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 8.481e-10 Identity = 26/39 (66.67%), Postives = 33/39 (84.62%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IV++WS+LLASIFSLLWVRIDPF+ K GP + CG++C Sbjct: 1053 IVIVWSILLASIFSLLWVRIDPFLAKNDGPLLEECGLDC 1091
BLAST of EX569643 vs. TAIR peptide
Match: AT5G17420.1 (| Symbols: IRX3, CESA7, ATCESA7, MUR10 | Cellulose synthase family protein | chr5:5736859-5741407 REVERSE LENGTH=1026) HSP 1 Score: 79.7221 bits (195), Expect = 4.814e-16 Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDT CGINC Sbjct: 988 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTSKCGINC 1026
BLAST of EX569643 vs. TAIR peptide
Match: AT5G05170.1 (| Symbols: CESA3, IXR1, ATCESA3, ATH-B, CEV1 | Cellulose synthase family protein | chr5:1530401-1535090 REVERSE LENGTH=1065) HSP 1 Score: 66.6254 bits (161), Expect = 4.217e-12 Identity = 30/39 (76.92%), Postives = 32/39 (82.05%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVV+WSVLLASIFSLLWVRIDPF + GPD CGINC Sbjct: 1027 IVVVWSVLLASIFSLLWVRIDPFTSRVTGPDILECGINC 1065
BLAST of EX569643 vs. TAIR peptide
Match: AT5G44030.1 (| Symbols: CESA4, IRX5, NWS2 | cellulose synthase A4 | chr5:17714713-17719564 FORWARD LENGTH=1049) HSP 1 Score: 62.3882 bits (150), Expect = 7.953e-11 Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IVV+WS+LLASIFSL+WVRIDPF+ K GP K CG++C Sbjct: 1011 IVVLWSILLASIFSLVWVRIDPFLPKQTGPLLKQCGVDC 1049
BLAST of EX569643 vs. TAIR peptide
Match: AT4G39350.1 (| Symbols: CESA2, ATH-A, ATCESA2 | cellulose synthase A2 | chr4:18297078-18301890 FORWARD LENGTH=1084) HSP 1 Score: 56.9954 bits (136), Expect = 3.342e-9 Identity = 24/39 (61.54%), Postives = 33/39 (84.62%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 I+V+WS+LLASI +LLWVR++PFV K GP ++CG+NC Sbjct: 1045 IIVVWSILLASILTLLWVRVNPFVAK-GGPVLEICGLNC 1082
BLAST of EX569643 vs. TAIR peptide
Match: AT5G64740.1 (| Symbols: CESA6, IXR2, E112, PRC1 | cellulose synthase 6 | chr5:25881555-25886333 FORWARD LENGTH=1084) HSP 1 Score: 55.0694 bits (131), Expect = 1.270e-8 Identity = 23/39 (58.97%), Postives = 33/39 (84.62%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 I+V+WS+LLASI +LLWVR++PFV K GP ++CG++C Sbjct: 1046 IIVVWSILLASILTLLWVRVNPFVAK-GGPILEICGLDC 1083
BLAST of EX569643 vs. TAIR peptide
Match: AT2G21770.1 (| Symbols: CESA9, CESA09 | cellulose synthase A9 | chr2:9284837-9289495 FORWARD LENGTH=1088) HSP 1 Score: 54.299 bits (129), Expect = 2.166e-8 Identity = 23/41 (56.10%), Postives = 34/41 (82.93%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC*K 124 I+++WS+LLASI +LLWVR++PFV K GP ++CG++C K Sbjct: 1049 IILVWSILLASILTLLWVRVNPFVSK-DGPVLEICGLDCLK 1088
BLAST of EX569643 vs. TAIR peptide
Match: AT5G09870.1 (| Symbols: CESA5 | cellulose synthase 5 | chr5:3073356-3077974 FORWARD LENGTH=1069) HSP 1 Score: 53.9138 bits (128), Expect = 2.829e-8 Identity = 22/39 (56.41%), Postives = 33/39 (84.62%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 I+++WS+LLASI +LLWVR++PFV K GP ++CG++C Sbjct: 1031 IILVWSILLASILTLLWVRVNPFVAK-GGPILEICGLDC 1068
BLAST of EX569643 vs. TAIR peptide
Match: AT4G18780.1 (| Symbols: CESA8, IRX1, ATCESA8, LEW2 | cellulose synthase family protein | chr4:10312846-10316719 REVERSE LENGTH=985) HSP 1 Score: 52.7582 bits (125), Expect = 6.302e-8 Identity = 24/39 (61.54%), Postives = 31/39 (79.49%), Query Frame = 2 Query: 2 IVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTKLCGINC 118 IV++WS+LLAS+FSL+WVRI+PFV KT DT +NC Sbjct: 945 IVILWSILLASVFSLVWVRINPFVSKT---DTTSLSLNC 980 The following BLAST results are available for this feature:
BLAST of EX569643 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 10
BLAST of EX569643 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 10
BLAST of EX569643 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 8
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EX569643 ID=EX569643; Name=EX569643; organism=Pisum sativum; type=EST; length=381bpback to top |