GH720345

EST Overview
NameGH720345
Unique NameGH720345
TypeEST
OrganismPisum sativum (pea)
Sequence length461
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Pisum sativum unigene v12010-12-27
Homology Analysis: Pisum sativum unigene v1 vs Trembl2010-12-28
Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide2011-02-03
InterProScan analysis for Pisum sativum unigene v12010-12-29
Libraries
Library NameType
LIBEST_024270 552Icdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of GH720345 vs. TrEMBL
Match: B7FJM2_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 5.765e-25
Identity = 51/75 (68.00%), Postives = 55/75 (73.33%), Query Frame = -1
Query:  120 SDQTKADXXXXXXXXXXXXXXXTAGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRPY 344
            S QTK++                AGTCN+F GKWVYDASYPLYD STCPFIDPQFNCQKHGRKDKLYQKYRW P+
Sbjct:   21 SHQTKSEDFNSFSNETNFEVSNIAGTCNLFRGKWVYDASYPLYDPSTCPFIDPQFNCQKHGRKDKLYQKYRWMPF 95          
BLAST of GH720345 vs. TrEMBL
Match: C6TI78_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 7.047e-23
Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = -1
Query:  120 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRPY 275
            AGTCN+F+GKWVYDAS PLYD STCPFIDPQFNCQKHGR DKLYQKYRW P+
Sbjct:   32 AGTCNLFSGKWVYDASNPLYDPSTCPFIDPQFNCQKHGRSDKLYQKYRWMPF 83          
BLAST of GH720345 vs. TrEMBL
Match: Q3LSN3_PEA (Putative uncharacterized protein OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 5.050e-21
Identity = 42/51 (82.35%), Postives = 46/51 (90.20%), Query Frame = -1
Query:  123 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 275
            AGTCN+F GKWVYDASYPLYD S+CPFIDPQFNCQK+GR D  YQKYRW+P
Sbjct:   50 AGTCNLFRGKWVYDASYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQP 100          
BLAST of GH720345 vs. TrEMBL
Match: Q3LSN2_PEA (Putative uncharacterized protein OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 5.050e-21
Identity = 42/51 (82.35%), Postives = 46/51 (90.20%), Query Frame = -1
Query:  123 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 275
            AGTCN+F GKWVYDASYPLYD S+CPFIDPQFNCQK+GR D  YQKYRW+P
Sbjct:   50 AGTCNLFRGKWVYDASYPLYDPSSCPFIDPQFNCQKYGRPDTQYQKYRWQP 100          
BLAST of GH720345 vs. TrEMBL
Match: D7TJJ6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_3.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00021192001 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 5.778e-17
Identity = 34/49 (69.39%), Postives = 42/49 (85.71%), Query Frame = -1
Query:  123 TCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 269
            +CN+F GKWV+DASYP YD+S CPFIDP+F+CQK+GR DK Y KY W+P
Sbjct:   55 SCNLFQGKWVFDASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSWKP 103          
BLAST of GH720345 vs. TrEMBL
Match: A5AGC3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_036403 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 5.778e-17
Identity = 34/49 (69.39%), Postives = 42/49 (85.71%), Query Frame = -1
Query:  123 TCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 269
            +CN+F GKWV+DASYP YD+S CPFIDP+F+CQK+GR DK Y KY W+P
Sbjct:   45 SCNLFQGKWVFDASYPFYDASNCPFIDPEFDCQKYGRPDKQYLKYSWKP 93          
BLAST of GH720345 vs. TrEMBL
Match: C6TH55_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.287e-16
Identity = 36/51 (70.59%), Postives = 41/51 (80.39%), Query Frame = -1
Query:  123 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 275
            A  CN+F G WV D SYPLYDSSTCPFIDP+F+CQK+GR DK Y KY W+P
Sbjct:   42 ANGCNLFLGSWVVDTSYPLYDSSTCPFIDPEFDCQKYGRPDKQYLKYAWKP 92          
BLAST of GH720345 vs. TrEMBL
Match: B9MW28_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_592181 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.287e-16
Identity = 37/52 (71.15%), Postives = 42/52 (80.77%), Query Frame = -1
Query:  120 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRPY 275
            AG CN F GKWV+D  YPLYDS+ CPFIDPQFNCQK+GR D  Y KYRW+P+
Sbjct:   46 AGKCNWFRGKWVFDPKYPLYDSN-CPFIDPQFNCQKYGRHDSSYLKYRWQPF 96          
BLAST of GH720345 vs. TrEMBL
Match: Q9SIN2_ARATH (Expressed protein OS=Arabidopsis thaliana GN=At2g42570 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 6.388e-16
Identity = 34/51 (66.67%), Postives = 38/51 (74.51%), Query Frame = -1
Query:  123 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 275
            +G CN F G WVYD  YPLYD   CPFIDPQFNC+K+GR D  Y KYRW+P
Sbjct:   44 SGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRWQP 94          
BLAST of GH720345 vs. TrEMBL
Match: D7LIU1_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_483351 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 6.388e-16
Identity = 34/51 (66.67%), Postives = 39/51 (76.47%), Query Frame = -1
Query:  123 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 275
            +G CN F G WVYDA YPLYD   CPFIDPQFNC+K+GR D  Y K+RW+P
Sbjct:   43 SGRCNWFRGNWVYDAKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKFRWQP 93          
BLAST of GH720345 vs. TAIR peptide
Match: AT2G42570.1 (| Symbols: TBL39 | TRICHOME BIREFRINGENCE-LIKE 39 | chr2:17717498-17719921 REVERSE LENGTH=367)

HSP 1 Score: 87.0409 bits (214), Expect = 4.780e-18
Identity = 34/51 (66.67%), Postives = 38/51 (74.51%), Query Frame = -1
Query:  123 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 275
            +G CN F G WVYD  YPLYD   CPFIDPQFNC+K+GR D  Y KYRW+P
Sbjct:   44 SGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRWQP 94          
BLAST of GH720345 vs. TAIR peptide
Match: AT2G30900.1 (| Symbols: TBL43 | TRICHOME BIREFRINGENCE-LIKE 43 | chr2:13150481-13152417 FORWARD LENGTH=368)

HSP 1 Score: 83.9593 bits (206), Expect = 4.047e-17
Identity = 33/50 (66.00%), Postives = 38/50 (76.00%), Query Frame = -1
Query:  117 CNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRPYG 266
            CNI+ G WVYD SYPLYDS  CPFI+ QFNC+ +GR D  Y KYRW+P G
Sbjct:   43 CNIYQGSWVYDKSYPLYDSKNCPFIERQFNCKSNGRPDSEYLKYRWQPSG 92          
BLAST of GH720345 vs. TAIR peptide
Match: AT2G31110.2 (| Symbols: | Plant protein of unknown function (DUF828) | chr2:13258522-13262071 REVERSE LENGTH=364)

HSP 1 Score: 83.1889 bits (204), Expect = 6.902e-17
Identity = 32/51 (62.75%), Postives = 40/51 (78.43%), Query Frame = -1
Query:  120 GTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRPY 272
            G CN+  GKWVYD+SYPLY + +CPFID +FNCQK GR D  YQ +RW+P+
Sbjct:   43 GRCNLARGKWVYDSSYPLYSAFSCPFIDSEFNCQKAGRPDTNYQHFRWQPF 93          
BLAST of GH720345 vs. TAIR peptide
Match: AT2G34070.1 (| Symbols: TBL37 | TRICHOME BIREFRINGENCE-LIKE 37 | chr2:14387631-14390160 REVERSE LENGTH=385)

HSP 1 Score: 82.8037 bits (203), Expect = 9.015e-17
Identity = 32/48 (66.67%), Postives = 39/48 (81.25%), Query Frame = -1
Query:  123 CNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 266
            CN+F G+WV+DASYP YDSSTCPFID +F+C K GR DK + KY W+P
Sbjct:   65 CNLFQGRWVFDASYPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSWQP 112          
BLAST of GH720345 vs. TAIR peptide
Match: AT1G29050.1 (| Symbols: TBL38 | TRICHOME BIREFRINGENCE-LIKE 38 | chr1:10136376-10139082 REVERSE LENGTH=380)

HSP 1 Score: 81.2629 bits (199), Expect = 2.623e-16
Identity = 32/51 (62.75%), Postives = 39/51 (76.47%), Query Frame = -1
Query:  123 AGTCNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 275
            A  CN+F G+WV+DASYP YDSS CPFID +F+C K GR DK + KY W+P
Sbjct:   58 ASGCNLFQGRWVFDASYPFYDSSKCPFIDGEFDCLKFGRPDKQFLKYSWQP 108          
BLAST of GH720345 vs. TAIR peptide
Match: AT3G14850.2 (| Symbols: TBL41 | TRICHOME BIREFRINGENCE-LIKE 41 | chr3:4995615-4997611 FORWARD LENGTH=356)

HSP 1 Score: 72.4034 bits (176), Expect = 1.218e-13
Identity = 28/48 (58.33%), Postives = 38/48 (79.17%), Query Frame = -1
Query:  123 CNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 266
            C++F G+WV D SYPLY+SSTCPFI  +F+CQ++GR D  Y  +RW+P
Sbjct:   34 CDMFTGRWVKDDSYPLYNSSTCPFIRHEFSCQRNGRPDLDYSTFRWQP 81          
BLAST of GH720345 vs. TAIR peptide
Match: AT5G19160.1 (| Symbols: TBL11 | TRICHOME BIREFRINGENCE-LIKE 11 | chr5:6430725-6432456 FORWARD LENGTH=464)

HSP 1 Score: 72.0182 bits (175), Expect = 1.591e-13
Identity = 28/48 (58.33%), Postives = 34/48 (70.83%), Query Frame = -1
Query:  123 CNIFNGKWVYDASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRP 266
            C++FNGKWV+D SYPLY S  C FID  F C + GR D  Y K+RW+P
Sbjct:   99 CDLFNGKWVWDESYPLYQSKDCTFIDEGFRCTEFGRPDLFYTKWRWQP 146          
BLAST of GH720345 vs. TAIR peptide
Match: AT5G01620.3 (| Symbols: TBL35 | TRICHOME BIREFRINGENCE-LIKE 35 | chr5:232882-234821 FORWARD LENGTH=457)

HSP 1 Score: 71.633 bits (174), Expect = 2.078e-13
Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = -1
Query:  120 CNIFNGKWVYD--ASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRPY 266
            C++F+GKWV+D  +SYPL+  S CP++  Q  CQKHGRKD  YQ +RW+P+
Sbjct:  118 CDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHWRWQPH 168          
BLAST of GH720345 vs. TAIR peptide
Match: AT5G01620.2 (| Symbols: | TRICHOME BIREFRINGENCE-LIKE 35 | chr5:232882-234821 FORWARD LENGTH=449)

HSP 1 Score: 71.633 bits (174), Expect = 2.078e-13
Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = -1
Query:  120 CNIFNGKWVYD--ASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRPY 266
            C++F+GKWV+D  +SYPL+  S CP++  Q  CQKHGRKD  YQ +RW+P+
Sbjct:  110 CDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHWRWQPH 160          
BLAST of GH720345 vs. TAIR peptide
Match: AT5G01620.1 (| Symbols: TBL35 | TRICHOME BIREFRINGENCE-LIKE 35 | chr5:232882-234821 FORWARD LENGTH=449)

HSP 1 Score: 71.633 bits (174), Expect = 2.078e-13
Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = -1
Query:  120 CNIFNGKWVYD--ASYPLYDSSTCPFIDPQFNCQKHGRKDKLYQKYRWRPY 266
            C++F+GKWV+D  +SYPL+  S CP++  Q  CQKHGRKD  YQ +RW+P+
Sbjct:  110 CDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHWRWQPH 160          
The following BLAST results are available for this feature:
BLAST of GH720345 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
B7FJM2_MEDTR5.765e-2568.00Putative uncharacterized protein OS=Medicago trunc... [more]
C6TI78_SOYBN7.047e-2386.54Putative uncharacterized protein OS=Glycine max PE... [more]
Q3LSN3_PEA5.050e-2182.35Putative uncharacterized protein OS=Pisum sativum ... [more]
Q3LSN2_PEA5.050e-2182.35Putative uncharacterized protein OS=Pisum sativum ... [more]
D7TJJ6_VITVI5.778e-1769.39Whole genome shotgun sequence of line PN40024, sca... [more]
A5AGC3_VITVI5.778e-1769.39Putative uncharacterized protein OS=Vitis vinifera... [more]
C6TH55_SOYBN1.287e-1670.59Putative uncharacterized protein (Fragment) OS=Gly... [more]
B9MW28_POPTR1.287e-1671.15Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
Q9SIN2_ARATH6.388e-1666.67Expressed protein OS=Arabidopsis thaliana GN=At2g4... [more]
D7LIU1_ARALY6.388e-1666.67Putative uncharacterized protein OS=Arabidopsis ly... [more]
back to top
BLAST of GH720345 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT2G42570.14.780e-1866.67| Symbols: TBL39 | TRICHOME BIREFRINGENCE-LIKE 39 ... [more]
AT2G30900.14.047e-1766.00| Symbols: TBL43 | TRICHOME BIREFRINGENCE-LIKE 43 ... [more]
AT2G31110.26.902e-1762.75| Symbols: | Plant protein of unknown function (D... [more]
AT2G34070.19.015e-1766.67| Symbols: TBL37 | TRICHOME BIREFRINGENCE-LIKE 37 ... [more]
AT1G29050.12.623e-1662.75| Symbols: TBL38 | TRICHOME BIREFRINGENCE-LIKE 38 ... [more]
AT3G14850.21.218e-1358.33| Symbols: TBL41 | TRICHOME BIREFRINGENCE-LIKE 41 ... [more]
AT5G19160.11.591e-1358.33| Symbols: TBL11 | TRICHOME BIREFRINGENCE-LIKE 11 ... [more]
AT5G01620.32.078e-1354.90| Symbols: TBL35 | TRICHOME BIREFRINGENCE-LIKE 35 ... [more]
AT5G01620.22.078e-1354.90| Symbols: | TRICHOME BIREFRINGENCE-LIKE 35 | chr... [more]
AT5G01620.12.078e-1354.90| Symbols: TBL35 | TRICHOME BIREFRINGENCE-LIKE 35 ... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSEGsegsegcoord: 20..36
score
NoneNo IPR availableSEGsegsegcoord: 39..55
score
NoneNo IPR availableSEGsegsegcoord: 1..18
score
NoneNo IPR availableSEGsegsegcoord: 23..39
score: NAcoord: 47..62
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GH720345 ID=GH720345|Name=GH720345|organism=Pisum sativum|type=EST|length=461bp
CGATTTCGAGCGGCCGCCCGGGCAGGTACCATCCTCATCTTTAACTACTT
GCACATCTTTCACAATATTTGGCAGAACCTTTGGAACAATGAAAATGAAA
TCCCTAGACTGAGCTGTCCATAGGGTCTCCACCTATATTTCTGATAAAGT
TTATCTTTTCGTCCATGTTTCTGACAATTGAACTGTGGATCTATGAAAGG
ACATGTTGAAGAATCATAGAGAGGATATGAAGCGTCGTACACCCATTTTC
CATTGAAAATGTTACACGTTCCTGCGGTGTTACTGGTTTCAAAACTTGTC
TCATTACTGAAAGAGTTAAAAAAATCTGCTTTTGTTTGGTCGGAAAACAG
AAACAGAGTAAGAAACAGAGCATGAAACAGAGTATGAAACAGAGCATTTA
CAAAAACAGAACCCATTTCCTCAGTTTTCGATCCCAACCCACACCTCGGC
CGCGACCACGC
back to top