AA430916

EST Overview
NameAA430916
Unique NameAA430916
TypeEST
OrganismPisum sativum (pea)
Sequence length583
Libraries
Library NameType
LIBEST_000872 Whero seedling lambda ZapII cDNA librarycdna_library
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Pisum sativum unigene v1Pisum sativum unigene v1EST
Homology
BLAST of AA430916 vs. TrEMBL
Match: A1BLP7_MEDTR (Thioredoxin h2 OS=Medicago truncatula PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.066e-37
Identity = 71/114 (62.28%), Postives = 93/114 (81.58%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSSVSA 390
            +VI +H+VE WK+ I+K N S KLIVVDFTASWCGPCRF+AP  AE+AK+ P +IFLKVD+DE+K++A+EW + AMPTFLF KEGKEVD++VGA K EL+   TKH +++  +A
Sbjct:    7 QVIGVHTVEQWKEEIQKGNDSKKLIVVDFTASWCGPCRFIAPILAEIAKKIPEVIFLKVDIDEVKSVAKEWSVEAMPTFLFLKEGKEVDKVVGARKEELENAITKHKDATVATA 120          
BLAST of AA430916 vs. TrEMBL
Match: Q45NL7_MEDSA (Thioredoxin h OS=Medicago sativa PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.012e-37
Identity = 72/111 (64.86%), Postives = 90/111 (81.08%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSS 381
            +VI +H+VE WK+++EK N S KLIVVDFTASWCGPCRF+AP  AE+AK+ P++ FLKVDVDELKT+AEEW + AMPTFLF KEGK VD++VGA K +LQ   TKH  + +
Sbjct:    7 QVIGVHTVEAWKEHLEKGNGSKKLIVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDVDELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKEQLQAAITKHATTDA 117          
BLAST of AA430916 vs. TrEMBL
Match: C9DFC1_NICBE (Thioredoxin H-type 1 (Fragment) OS=Nicotiana benthamiana GN=TRXh PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.026e-36
Identity = 69/114 (60.53%), Postives = 90/114 (78.95%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSSVSA 390
            +V   H VE+W ++ +K   + KL+VVDFTASWCGPCRF+AP  A++AK+ PH+IFLKVDVDELKT+AEEW + AMPTF+F K+GKEVDR+VGA K ELQ+   KH   ++V+A
Sbjct:    6 QVFGCHKVEEWNEHFQKGVETKKLVVVDFTASWCGPCRFIAPVLADIAKKMPHVIFLKVDVDELKTVAEEWSVEAMPTFVFLKDGKEVDRVVGAKKEELQQTILKHAAPATVTA 119          
BLAST of AA430916 vs. TrEMBL
Match: A1BLP6_MEDTR (Thioredoxin h1 OS=Medicago truncatula PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.339e-36
Identity = 72/110 (65.45%), Postives = 89/110 (80.91%), Query Frame = 1
Query:   52 VISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSS 381
            VI +H+VE WK+++EK N S KLIVVDFTASWCGPCRF+AP  AE+AK+ P++ FLKVDVDELKT+AEEW + AMPTFLF KEGK VD++VGA K +LQ   TKH  + +
Sbjct:    8 VIGVHTVEAWKEHLEKGNGSKKLIVVDFTASWCGPCRFIAPILAEIAKKLPNVTFLKVDVDELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKDQLQAAITKHATTDA 117          
BLAST of AA430916 vs. TrEMBL
Match: B6EAX5_SALMI (TRX OS=Salvia miltiorrhiza GN=Trx PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.285e-36
Identity = 70/107 (65.42%), Postives = 90/107 (84.11%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHG 369
            +VIS HSV++WK++ +K   S+KL+VVDFTASWCGPCRF+AP  AE+AK+ PH+IFLKVDVDELKT+A+E+ I AMP+FLF KEGKE+DR+VGA K +L    T+HG
Sbjct:    8 QVISCHSVDEWKEHFQKGVDSNKLVVVDFTASWCGPCRFIAPILAEIAKKTPHVIFLKVDVDELKTVAQEYNIEAMPSFLFIKEGKEIDRVVGARKEDLLAKVTQHG 114          
BLAST of AA430916 vs. TrEMBL
Match: Q93X24_PEA (Thioredoxin h OS=Pisum sativum GN=trxh PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.134e-35
Identity = 71/106 (66.98%), Postives = 85/106 (80.19%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKH 366
            EVI++HS E WK+ I+K   S KLIVVDFTASWCGPCRF+AP  AE+AK+ P +IFLKVD+DEL+++AEEW I AMPTFL  KEG EVD++VGA K ELQ   TKH
Sbjct:    6 EVIAVHSDESWKEQIQKGTESKKLIVVDFTASWCGPCRFIAPILAEIAKKTPQVIFLKVDIDELESVAEEWSIEAMPTFLLLKEGMEVDKVVGAKKEELQLAITKH 111          
BLAST of AA430916 vs. TrEMBL
Match: Q6RJZ7_CAPAN (Thioredoxin OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.481e-35
Identity = 70/115 (60.87%), Postives = 92/115 (80.00%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKH-GESSSVSA 390
            +V   H+VE+W ++ +K   + KL+VVDFTASWCGPCRF+AP  A++AK+ PH+IFLKVDVDELKT+AEEW + AMPTF+FFK+G+EVDR+VGA K ELQ    KH G  ++V+A
Sbjct:   10 QVFGCHNVEEWDQHFKKGVETKKLVVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTVAEEWNVDAMPTFVFFKDGEEVDRVVGAQKEELQAAILKHVGAPATVTA 124          
BLAST of AA430916 vs. TrEMBL
Match: Q00P17_EUCGR (Thioredoxin h OS=Eucalyptus grandis PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.934e-35
Identity = 71/111 (63.96%), Postives = 86/111 (77.48%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSS 381
            +VIS HS E W + I K N SDKL+VVDFTASWCGPCRF+AP  AELAK  P+++FLKVDVDELKT+A+EW + AMPTF+F K GK VDR+VGA K +LQ    KH  ++S
Sbjct:    6 QVISCHSAESWSEQIAKSNESDKLVVVDFTASWCGPCRFIAPFLAELAKRFPNVLFLKVDVDELKTVAQEWAVEAMPTFMFVKGGKIVDRVVGAQKDQLQMTLAKHMATAS 116          
BLAST of AA430916 vs. TrEMBL
Match: Q8GUR9_PEA (Thioredoxin h OS=Pisum sativum PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 9.599e-35
Identity = 69/106 (65.09%), Postives = 85/106 (80.19%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKH 366
            +VI +H+V+ WK+ +EK   S KLIVVDFTASWCGPCRF+AP  AE+AK+  H+ FLKVDVDELKT++EEWGI AMPTFLF K+G+ VD++VGA K ELQ    KH
Sbjct:    6 QVIGVHTVDAWKEQLEKGKASKKLIVVDFTASWCGPCRFIAPILAEIAKKLTHVTFLKVDVDELKTVSEEWGIEAMPTFLFLKDGELVDKVVGAKKEELQLKIDKH 111          
BLAST of AA430916 vs. TrEMBL
Match: Q201Z4_9SOLN (Thioredoxin OS=Solanum berthaultii PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 8.126e-34
Identity = 67/112 (59.82%), Postives = 86/112 (76.79%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSSV 384
            +VI  H VEDW+   +K   + KL+VVDFTASWCGPCRF+AP  A++AK+  H+IFLKVDVDELK +AE+W + AMPTF+F KEGKEVDR+VGANK  L +   KHG + ++
Sbjct:    9 QVIGCHKVEDWEVQPQKGVETKKLVVVDFTASWCGPCRFIAPILADIAKKMHHVIFLKVDVDELKKVAEDWNVEAMPTFVFIKEGKEVDRVVGANKDGLLQTIEKHGAAPAI 120          
BLAST of AA430916 vs. SwissProt
Match: TRXH1_TOBAC (Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.842e-37
Identity = 68/114 (59.65%), Postives = 89/114 (78.07%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSSVSA 390
            +V   H VE+W +Y +K   + KL+VVDFTASWCGPCRF+AP  A++AK+ PH+IFLKVDVDELKT++ EW + AMPTF+F K+GKEVDR+VGA K ELQ+   KH   ++V+A
Sbjct:   13 QVFGCHKVEEWNEYFKKGVETKKLVVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKHAAPATVTA 126          
BLAST of AA430916 vs. SwissProt
Match: TRXH1_ARATH (Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.724e-34
Identity = 64/106 (60.38%), Postives = 85/106 (80.19%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKH 366
            +VI+ H+VE W + ++K N S  L+VVDFTASWCGPCRF+AP FA+LAK+ P+++FLKVD DELK++A +W I+AMPTF+F KEGK +D++VGA K ELQ    KH
Sbjct:    7 QVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112          
BLAST of AA430916 vs. SwissProt
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 3.841e-34
Identity = 66/111 (59.46%), Postives = 86/111 (77.48%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSS 381
            +VI  H+VE W + ++K N +  LIVVDFTASWCGPCRF+AP  AELAK+ P++ FLKVDVDELKT+A EW + +MPTF+F KEGK +D++VGA K ELQ+   KH  ++S
Sbjct:    7 QVIGCHTVEAWNEQLQKGNDTKGLIVVDFTASWCGPCRFIAPFLAELAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKHMATAS 117          
BLAST of AA430916 vs. SwissProt
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.490e-33
Identity = 64/113 (56.64%), Postives = 87/113 (76.99%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSSVS 387
            +VI +H+V+ W ++++K     KLIVVDFTASWCGPC+F+A  +AELAK+ P + FLKVDVDELK++A +W + AMPTF+F KEGK VD++VGA K ELQ+   KH  S+S +
Sbjct:    6 QVIGVHTVDAWNEHLQKGIDDKKLIVVDFTASWCGPCKFIASFYAELAKKMPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHISSTSTA 118          
BLAST of AA430916 vs. SwissProt
Match: TRXH_WHEAT (Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3)

HSP 1 Score: 139.043 bits (349), Expect = 1.614e-32
Identity = 68/107 (63.55%), Postives = 82/107 (76.64%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHG 369
            EVIS+HS+E W   IE+ N + KL+V+DFTASWCGPCR MAP FA+LAK+ P  +FLKVDVDELK +AE++ + AMPTFLF KEG   DR+VGA K EL   TTK G
Sbjct:   19 EVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEEL---TTKVG 122          
BLAST of AA430916 vs. SwissProt
Match: TRXH5_ARATH (Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 3.365e-30
Identity = 58/107 (54.21%), Postives = 82/107 (76.64%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHG 369
            EVI+ H++E W + ++  N S KLIV+DFTASWC PCRF+AP FAE+AK+  +++F K+DVDEL+ +A+E+ + AMPTF+F KEG  +DR+VGA K E+ +   KHG
Sbjct:    6 EVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHG 112          
BLAST of AA430916 vs. SwissProt
Match: TRXH_ORYSI (Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.279e-29
Identity = 58/113 (51.33%), Postives = 83/113 (73.45%), Query Frame = 1
Query:   52 VISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSSVSA 390
            VI+ H+ +++   + K   + K++++DFTASWCGPCRF+AP FAE AK+ P  +FLKVDVDELK +AE++ + AMPTFLF K+G E D++VGA K +LQ    KH  +++ SA
Sbjct:    8 VIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASA 120          
BLAST of AA430916 vs. SwissProt
Match: TRXH1_ORYSJ (Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.279e-29
Identity = 58/113 (51.33%), Postives = 83/113 (73.45%), Query Frame = 1
Query:   52 VISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGESSSVSA 390
            VI+ H+ +++   + K   + K++++DFTASWCGPCRF+AP FAE AK+ P  +FLKVDVDELK +AE++ + AMPTFLF K+G E D++VGA K +LQ    KH  +++ SA
Sbjct:    8 VIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASA 120          
BLAST of AA430916 vs. SwissProt
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.181e-29
Identity = 57/100 (57.00%), Postives = 78/100 (78.00%), Query Frame = 1
Query:   46 AEVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVEL 345
            A+VI+ H+V++W +  +K   S KLIV+DFTASWCGPCR + P  +ELAK+ PH+ F KVDVD+LK +AEE+ + AMP+F+  KEG+EV+R+VGA K EL
Sbjct:    5 AQVIACHTVQEWNEKFQKAKDSGKLIVIDFTASWCGPCRVITPYVSELAKKFPHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDEL 104          
BLAST of AA430916 vs. SwissProt
Match: TRXH3_ARATH (Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.859e-29
Identity = 59/106 (55.66%), Postives = 80/106 (75.47%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKH 366
            EVI+ H+VEDW + ++  N S KLIV+DFTA+WC PCRF+AP FA+LAK+   ++F KVDVDEL T+AEE+ ++AMPTF+F KEG+  + +VGA K E+     KH
Sbjct:    6 EVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKH 111          
BLAST of AA430916 vs. TAIR peptide
Match: AT3G51030.1 (| Symbols: ATTRX1, ATTRX H1, TRX1 | thioredoxin H-type 1 | chr3:18951123-18951955 REVERSE LENGTH=114)

HSP 1 Score: 145.591 bits (366), Expect = 1.821e-35
Identity = 64/106 (60.38%), Postives = 85/106 (80.19%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKH 366
            +VI+ H+VE W + ++K N S  L+VVDFTASWCGPCRF+AP FA+LAK+ P+++FLKVD DELK++A +W I+AMPTF+F KEGK +D++VGA K ELQ    KH
Sbjct:    7 QVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112          
BLAST of AA430916 vs. TAIR peptide
Match: AT1G45145.1 (| Symbols: ATTRX5, ATH5, LIV1, TRX5 | thioredoxin H-type 5 | chr1:17075264-17076256 REVERSE LENGTH=118)

HSP 1 Score: 131.339 bits (329), Expect = 3.553e-31
Identity = 58/107 (54.21%), Postives = 82/107 (76.64%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHG 369
            EVI+ H++E W + ++  N S KLIV+DFTASWC PCRF+AP FAE+AK+  +++F K+DVDEL+ +A+E+ + AMPTF+F KEG  +DR+VGA K E+ +   KHG
Sbjct:    6 EVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHG 112          
BLAST of AA430916 vs. TAIR peptide
Match: AT5G42980.1 (| Symbols: ATTRX3, ATH3, ATTRXH3, TRXH3, TRX3 | thioredoxin 3 | chr5:17242772-17243718 FORWARD LENGTH=118)

HSP 1 Score: 127.487 bits (319), Expect = 5.131e-30
Identity = 59/106 (55.66%), Postives = 80/106 (75.47%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKH 366
            EVI+ H+VEDW + ++  N S KLIV+DFTA+WC PCRF+AP FA+LAK+   ++F KVDVDEL T+AEE+ ++AMPTF+F KEG+  + +VGA K E+     KH
Sbjct:    6 EVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKH 111          
BLAST of AA430916 vs. TAIR peptide
Match: AT1G19730.1 (| Symbols: ATTRX4, ATH4 | Thioredoxin superfamily protein | chr1:6823163-6824020 REVERSE LENGTH=119)

HSP 1 Score: 120.168 bits (300), Expect = 8.191e-28
Identity = 58/107 (54.21%), Postives = 78/107 (72.90%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKE-KPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKH 366
            +VI  H+ + W   ++K   S+KLIV+DFTASWC PCR +AP F +LAK+     IF KVDVDEL+++A+E+G+ AMPTF+F K G+ VD+LVGANK +LQ    KH
Sbjct:    7 QVIGCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKH 113          
BLAST of AA430916 vs. TAIR peptide
Match: AT3G17880.2 (| Symbols: HIP, ATTDX, ATHIP2, TDX | tetraticopeptide domain-containing thioredoxin | chr3:6123534-6126113 FORWARD LENGTH=373)

HSP 1 Score: 110.538 bits (275), Expect = 6.490e-25
Identity = 46/109 (42.20%), Postives = 75/109 (68.81%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGES 375
            EVISIHS  + +   +    + +L+++ FTA+WCGPCR+M+P ++ LA +   ++FLKVD+D+   +A  W I ++PTF F ++GKEVD++VGA+K  L++   +H  S
Sbjct:  264 EVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSSS 372          
BLAST of AA430916 vs. TAIR peptide
Match: AT3G17880.1 (| Symbols: HIP, ATTDX, ATHIP2, TDX | tetraticopeptide domain-containing thioredoxin | chr3:6123534-6126113 FORWARD LENGTH=380)

HSP 1 Score: 110.538 bits (275), Expect = 6.490e-25
Identity = 46/109 (42.20%), Postives = 75/109 (68.81%), Query Frame = 1
Query:   49 EVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTKHGES 375
            EVISIHS  + +   +    + +L+++ FTA+WCGPCR+M+P ++ LA +   ++FLKVD+D+   +A  W I ++PTF F ++GKEVD++VGA+K  L++   +H  S
Sbjct:  271 EVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSSS 379          
BLAST of AA430916 vs. TAIR peptide
Match: AT5G39950.1 (| Symbols: ATTRX2, ATH2, ATTRXH2, TRXH2, TRX2 | thioredoxin 2 | chr5:15990885-15991881 REVERSE LENGTH=133)

HSP 1 Score: 103.99 bits (258), Expect = 6.075e-23
Identity = 47/112 (41.96%), Postives = 74/112 (66.07%), Query Frame = 1
Query:   28 GRKRKMAEVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITTK 363
            G + + + V+   S   W+ +  +   S+KL+VVDF+ASWCGPCR + P    +A +   + F+K+DVDEL  +A+E+ + AMPTF+  K GKE++R++GA K EL+K  +K
Sbjct:   19 GTESEPSRVLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSK 130          
BLAST of AA430916 vs. TAIR peptide
Match: AT3G08710.2 (| Symbols: ATH9, TRX H9, TH9 | thioredoxin H-type 9 | chr3:2645590-2646304 FORWARD LENGTH=140)

HSP 1 Score: 103.605 bits (257), Expect = 7.934e-23
Identity = 45/100 (45.00%), Postives = 67/100 (67.00%), Query Frame = 1
Query:   61 IHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITT 360
            I + E W   + + +   K++V +F+A+WCGPC+ +AP F EL+++   ++FL VDVDEL   +  W I+A PTF F K G+++ +LVGANK ELQK  T
Sbjct:   28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQIGKLVGANKPELQKKVT 127          
BLAST of AA430916 vs. TAIR peptide
Match: AT3G08710.1 (| Symbols: ATH9, TRX H9, TH9 | thioredoxin H-type 9 | chr3:2645590-2646304 FORWARD LENGTH=140)

HSP 1 Score: 103.605 bits (257), Expect = 7.934e-23
Identity = 45/100 (45.00%), Postives = 67/100 (67.00%), Query Frame = 1
Query:   61 IHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKITT 360
            I + E W   + + +   K++V +F+A+WCGPC+ +AP F EL+++   ++FL VDVDEL   +  W I+A PTF F K G+++ +LVGANK ELQK  T
Sbjct:   28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQIGKLVGANKPELQKKVT 127          
BLAST of AA430916 vs. TAIR peptide
Match: AT3G56420.1 (| Symbols: | Thioredoxin superfamily protein | chr3:20922140-20922890 REVERSE LENGTH=154)

HSP 1 Score: 101.679 bits (252), Expect = 3.015e-22
Identity = 45/111 (40.54%), Postives = 70/111 (63.06%), Query Frame = 1
Query:   25 RGRKRKMAEVISIHSVEDWKKYIEKENTSDKLIVVDFTASWCGPCRFMAPTFAELAKEKPHIIFLKVDVDELKTLAEEWGIRAMPTFLFFKEGKEVDRLVGANKVELQKIT 357
            R +     +V  +  +E W++ I + N   K++VV+F+A WC PC+ + P F +LA   P +IF+ VDV+EL   + EW + A PT +F K+G+++D+LVGA   ELQK T
Sbjct:   33 RSQHGSKGKVHPVSRIEKWEEKITEANNHGKILVVNFSAPWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEFSNEWNVEATPTVVFLKDGRQMDKLVGAETSELQKKT 143          
The following BLAST results are available for this feature:
BLAST of AA430916 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
A1BLP7_MEDTR2.066e-3762.28Thioredoxin h2 OS=Medicago truncatula PE=4 SV=1[more]
Q45NL7_MEDSA6.012e-3764.86Thioredoxin h OS=Medicago sativa PE=4 SV=1[more]
C9DFC1_NICBE1.026e-3660.53Thioredoxin H-type 1 (Fragment) OS=Nicotiana benth... [more]
A1BLP6_MEDTR1.339e-3665.45Thioredoxin h1 OS=Medicago truncatula PE=4 SV=1[more]
B6EAX5_SALMI2.285e-3665.42TRX OS=Salvia miltiorrhiza GN=Trx PE=4 SV=1[more]
Q93X24_PEA1.134e-3566.98Thioredoxin h OS=Pisum sativum GN=trxh PE=4 SV=1[more]
Q6RJZ7_CAPAN1.481e-3560.87Thioredoxin OS=Capsicum annuum PE=2 SV=1[more]
Q00P17_EUCGR1.934e-3563.96Thioredoxin h OS=Eucalyptus grandis PE=4 SV=1[more]
Q8GUR9_PEA9.599e-3565.09Thioredoxin h OS=Pisum sativum PE=4 SV=1[more]
Q201Z4_9SOLN8.126e-3459.82Thioredoxin OS=Solanum berthaultii PE=2 SV=1[more]
back to top
BLAST of AA430916 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
TRXH1_TOBAC2.842e-3759.65Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=... [more]
TRXH1_ARATH1.724e-3460.38Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=... [more]
TRXH_RICCO3.841e-3459.46Thioredoxin H-type OS=Ricinus communis PE=3 SV=1[more]
TRXH2_TOBAC2.490e-3356.64Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=... [more]
TRXH_WHEAT1.614e-3263.55Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3[more]
TRXH5_ARATH3.365e-3054.21Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=... [more]
TRXH_ORYSI1.279e-2951.33Thioredoxin H-type OS=Oryza sativa subsp. indica G... [more]
TRXH1_ORYSJ1.279e-2951.33Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=... [more]
TRXH_FAGES2.181e-2957.00Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV... [more]
TRXH3_ARATH4.859e-2955.66Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=... [more]
back to top
BLAST of AA430916 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G51030.11.821e-3560.38| Symbols: ATTRX1, ATTRX H1, TRX1 | thioredoxin H-... [more]
AT1G45145.13.553e-3154.21| Symbols: ATTRX5, ATH5, LIV1, TRX5 | thioredoxin ... [more]
AT5G42980.15.131e-3055.66| Symbols: ATTRX3, ATH3, ATTRXH3, TRXH3, TRX3 | th... [more]
AT1G19730.18.191e-2854.21| Symbols: ATTRX4, ATH4 | Thioredoxin superfamily ... [more]
AT3G17880.26.490e-2542.20| Symbols: HIP, ATTDX, ATHIP2, TDX | tetraticopept... [more]
AT3G17880.16.490e-2542.20| Symbols: HIP, ATTDX, ATHIP2, TDX | tetraticopept... [more]
AT5G39950.16.075e-2341.96| Symbols: ATTRX2, ATH2, ATTRXH2, TRXH2, TRX2 | th... [more]
AT3G08710.27.934e-2345.00| Symbols: ATH9, TRX H9, TH9 | thioredoxin H-type ... [more]
AT3G08710.17.934e-2345.00| Symbols: ATH9, TRX H9, TH9 | thioredoxin H-type ... [more]
AT3G56420.13.015e-2240.54| Symbols: | Thioredoxin superfamily protein | ch... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005746ThioredoxinPRINTSPR00421THIOREDOXINcoord: 39..47
score: 1.5e-08coord: 47..56
score: 1.5e-08coord: 86..97
score: 1.5
IPR005746ThioredoxinPANTHERPTHR10438THIOREDOXIN-RELATEDcoord: 29..121
score: 1.6
IPR005746ThioredoxinTIGRFAMsTIGR01068thioredoxin: thioredoxincoord: 20..121
score: 5.7
IPR012335Thioredoxin foldGENE3D3.40.30.10no descriptioncoord: 16..121
score: 1.4
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 2..110
score: 3.5
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 20..119
score: 8.2
IPR017936Thioredoxin-likePROFILEPS51352THIOREDOXIN_2coord: 1..122
score: 13
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 40..58
score
NoneNo IPR availablePANTHERPTHR10438:SF16THIOREDOXIN H-TYPE-RELATEDcoord: 29..121
score: 1.6
NoneNo IPR availableSEGsegsegcoord: 96..110
score
NoneNo IPR availableSEGsegsegcoord: 41..52
score: NAcoord: 80..96
score

Properties
Property NameValue
Singlet in analysisPisum sativum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>AA430916 ID=AA430916|Name=AA430916|organism=Pisum sativum|type=EST|length=583bp
ATTTGAAGTGAAAGGTGTGATTTTCGAGGAAGAAAGAGAAAAATGGCAGA
AGTGATCAGTATTCACAGCGTGGAGGATTGGAAGAAATATATCGAGAAGG
AGAATACCTCCGATAAACTGATTGTTGTAGATTTCACTGCTTCTTGGTGT
GGTCCATGCCGTTTCATGGCGCCAACTTTTGCAGAGCTTGCAAAAGAGAA
GCCACATATCATCTTCCTCAAGGTTGACGTTGATGAATTGAAGACTCTTG
CTGAAGAGTGGGGAATTAGAGCTATGCCAACATTCTTGTTCTTCAAAGAA
GGAAAGGAAGTGGACAGACTTGTGGGTGCTAACAAGGTTGAGCTGCAAAA
GATAACAACCAAGCATGGAGAGTCTTCGAGTGTTTCTGCTTGAGGAGTCA
TATCATACGAAGAAATGTCTGTTTGTCTGTAGCTATATGTTCTTGAATAT
TCAGAATATGATATGCATGAAGAGTGTTTCTGCATTTGAAAAATAAAAGT
ATGTTTGTCTGTTTTCAATATGGTTTGGAATTTAGAAATGTAGAATATAT
TTGATATTTGAATAATATAGTTGTGTTGTGTGT
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: Biological Process
TermDefinition
GO:0006662glycerol ether metabolic process
GO:0045454cell redox homeostasis
Vocabulary: Molecular Function
TermDefinition
GO:0009055electron transfer activity
GO:0015035protein disulfide oxidoreductase activity
Vocabulary: INTERPRO
TermDefinition
IPR005746Thioredoxin
IPR012335Thioredoxin fold
IPR012336Thioredoxin-like_fold
IPR013766Thioredoxin_domain
IPR017936Thioredoxin-like
IPR017937Thioredoxin_CS